KEGG   Camelus dromedarius (Arabian camel): 105099149
Entry
105099149         CDS       T04642                                 

Gene name
AFF3
Definition
(RefSeq) LOW QUALITY PROTEIN: AF4/FMR2 family member 3
  KO
K15195  AF4/FMR2 family member 3
Organism
cdk  Camelus dromedarius (Arabian camel)
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cdk03021]
    105099149 (AFF3)
Transcription machinery [BR:cdk03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     105099149 (AFF3)
SSDB
Motif
Pfam: AF-4 AF-4_C AF4_int
Other DBs
NCBI-GeneID: 105099149
NCBI-ProteinID: XP_031296962
Position
28
AA seq 1200 aa
MVLEQVQSELCALSVYEPDRNVLRRKERERRNQETQQDDGTFNSSYSLFSEPYKTNKGDE
LSNRIQNTLGNYDEMKDFLTDRSNQTHLVGVPKPGVPPAPVNKIDEHFVADSRAQPQPAS
VCSTASSSPAAVPGQQSKRATVGWQKAGHQPSDGQQRATTQGSLRTLLGDGVGRQQPRTK
QVCNVEVGLQTQERPPAMAAKHGSGGHCVQNFPPSLASKPSLVQQKPTAYVRPMDGQDQA
PDESPKLKSSTETSVHCPSHRGAPAAKPESARAKAKLAKFSIPKQGEENRSGETNSCVEE
IIREMTWLPPLSAVQAPGKVEQSKFPFPNKDSQLVSSGHNNPKKGGAEPGSPDNGTSNTS
MLEDDLKLSSDEEENEQQAAQRTALHALSDSAGAQQASGRASAPSSKGSSSGSSSSGSSS
SSDSESSSGSDSETESSSSESEGSKPPHYSSPEAEPASSNKWQLDKWLNKVNPHKPPILI
QNESHGPESNQYYTAAKDEAPDCGKLPEVCPPSLREKDIKSACKEEQRPRTANKAPGSKG
VKQKSPPAAGPCGPARRRAGGGGERVRGGXESGKRRXRWRGAAPRPRSPPPTSAGERGVR
QAQACGNSRTSHRKELRSSVTCEKRRTRGLSRIVPKSKEFIETESSSSSSSSDSDLESEQ
EDYPLSKAQAVAGAAAPGGATRGQEAANSVGRAPRAPVGSINARTTSDIAKELEEQFYTL
VPFGRNELLSPLKDSDDVRSLWVKIDLTLLSRVPEHLPQEPGVLSAPAAKDSESAPLSHA
SDAPAEKALPKSKRKRKCDNEDDYREVKKAQGEKESSSRLTASANGTLSANHCNVSISSL
AIPINKNEKMLRSPISPASDASKHKYSGEDFTSCGRPGSNGLLTSASASKKHKPESQLPT
HAGDVTKAAHNASENVLHKSRPQTEPWSPGSNGHRDCKRQKLVFDDMPRSADYFMQEAKR
MKHKADAMVEKFGKALNYAEAALSFIECGNAMEQGPMESKSPYTMYSETVELIRYAMRLK
THSGPNATPEDKQLAALCYRCLALLYWRMFRLKRDHAVKYSKALIDYFKNSSKAAQAPSP
WGASGKSTGTPSPMSPNPSPTNSVGSQGSLSNASTLSPSTIVSIPQRIHQMAANHVSITN
SILHSYDYWEMADSLAKENREFFNDLDLLMGPVTLHSSMEHLVQYSQQGLHWLRNSAHLS
NT seq 3603 nt   +upstreamnt  +downstreamnt
atggtactggaacaagtgcagtcagagctatgtgctctcagcgtctatgaaccagataga
aacgtgttacggaggaaagaacgagaaagaagaaatcaggaaactcaacaggatgatggc
acgtttaattcgagttactccctcttcagtgaaccctacaagactaacaagggggatgag
ctctccaaccggatccagaacacgttgggcaattatgatgagatgaaagactttttaacg
gatagatccaatcagactcacctcgtgggtgttcccaagcctggggtccctccggctccc
gtgaacaagattgacgagcatttcgttgcagattcaagggcccagccccagcctgcatcc
gtctgtagcacggcgtcctcctcgccggcagctgtccccgggcagcagagcaagcgggcc
accgtgggctggcagaaggctggccaccagccctccgacggccagcagagagcaacaaca
cagggctctctcaggaccttgctcggagatggtgtcggcagacagcagccacggaccaag
caggtgtgcaatgttgaggtgggtcttcagacccaggaaaggcccccagctatggcagcc
aagcacggcagcggcggacactgtgttcagaactttcctccatccctggcttcgaaacct
agcctggtccagcagaaacccaccgcctacgtgcggccaatggacggccaggaccaggct
cccgatgagtctccgaagcttaaatcatccacagaaaccagcgtgcactgcccatcacac
cggggagccccagctgccaagccagaatctgccagagccaaggccaagcttgccaagttc
agcatccccaaacagggagaggagaatagatctggagaaaccaacagctgtgttgaagaa
atcattcgggagatgacctggcttcccccactctctgctgttcaagcacctggcaaagtg
gaacaaagcaaatttccatttccaaataaggactctcagctcgtttcctcgggacacaat
aatccaaagaaaggtggtgctgagccagggagtccggacaatggcacgtcgaatacatca
atgctagaagatgaccttaagctaagtagtgatgaagaggagaatgaacagcaggcagcc
cagagaacggctctccacgctctgtctgacagcgccggggcccagcaggccagcggcagg
gcctccgcgccttccagcaagggtagcagcagcggcagcagcagcagcgggagcagctcc
tccagcgactcggagagcagctcggggtccgactcggagaccgagagcagttccagcgag
agtgagggcagcaagcccccccactactccagccccgaggccgaaccagcgtcctccaac
aagtggcagctggataaatggctaaacaaagttaatccccacaagcctcctattctgatc
caaaacgaaagccacgggccggagagcaaccagtactacaccgcggcgaaggacgaagcg
cccgactgtgggaagcttcccgaagtctgcccgcccagcctgagggagaaggacatcaag
agcgcctgcaaggaggagcagcggccgaggaccgcgaacaaggccccagggagcaaaggc
gtgaagcagaagtccccgcccgcggccgggccgtgtggccctgcccgccggagagcgggg
ggggggggggagagagtgcgcggggggtaagagtccgggaagcggagatagaggtggcgg
ggggcggcaccgaggccgaggagcccgccgcccacaagcgctggcgagcgcggggtccgc
caagcccaggcctgcggcaacagcaggacgagccaccgcaaggagctgcgctcgtccgtg
acctgcgagaagcgccgcacgcgggggctgagccggatcgtccccaaatccaaggagttc
atcgagaccgagtcgtcgtcgtcgtcctcctcctcggactcggacctggagtcggagcag
gaggactaccctctgtccaaggcgcaggccgtggccggcgccgccgcgccggggggagcg
accagaggccaggaggccgccaacagcgtcggcagggcgccccgcgcccccgtgggctcc
atcaacgccaggaccaccagcgacatcgccaaggagctggaggagcagttctacacgctg
gtccccttcggccgcaacgaacttctctcccccttgaaggacagtgacgacgtcaggtct
ctctgggtcaaaattgacctgaccctcctgtccagggtcccagaacacctgccccaagag
ccgggggtcttgagcgctcctgcggccaaggactctgagagcgccccgctgagccacgca
tcagacgcgccagcagaaaaggctttgccaaaatccaagaggaaacgcaagtgtgacaac
gaagacgactacagggaggtcaagaaggcccagggagagaaggagagctcttcacgactg
actgcctctgccaacggtactttgtctgcaaaccactgcaacgtgagcatcagcagcttg
gcaataccaataaacaaaaatgaaaaaatgctgcggtcgcccatctcccccgcatccgac
gcgtctaaacacaaatactcaggtgaggacttcacctcctgcggccgacccggcagcaat
ggcttgcttacctccgcctccgccagcaagaagcataagccggagagccagctgccgacc
cacgccggggacgtcacgaaagcggctcacaacgcttccgagaacgttctccacaagtca
cggccacagacagagccatggtctccaggctccaacggccacagggactgcaagaggcag
aaacttgtcttcgacgacatgccacgcagtgcagattattttatgcaagaagctaaacga
atgaagcataaagcagatgcgatggtggaaaagtttggaaaggctctgaactacgcagaa
gcagccttgtcgttcatcgagtgcggaaatgccatggagcaaggccccatggaatccaag
tctccctacacgatgtactcagagacggtggagctcatcaggtatgctatgagactaaaa
acccactcaggccccaacgccacaccagaggataaacagttggctgcattgtgttaccga
tgcctggccctcctgtactggcggatgtttcgactcaaaagggatcacgctgtaaagtat
tccaaagcacttatcgactattttaagaattcatctaaagctgcccaagccccgtctccg
tggggggccagtggaaagagcacgggaactccatcccccatgtctcccaacccctcgccc
accaactccgtgggatctcaggggagcctctccaacgccagcaccctgtccccctcaacc
atcgtcagcatcccacagcgcatccaccagatggccgccaatcacgtcagcatcaccaac
agcatcctccacagctacgactactgggagatggcagacagcctggccaaggagaacaga
gaattcttcaacgacctggacctgctcatggggccggtcaccctgcacagcagcatggag
cacctggtccagtactcccagcagggcctgcactggctgcggaacagcgcccacctgtcg
tag

DBGET integrated database retrieval system