KEGG   Camelus dromedarius (Arabian camel): 105099988Help
Entry
105099988         CDS       T04642                                 

Gene name
LHX4
Definition
(RefSeq) LIM/homeobox protein Lhx4
  KO
K09374  LIM homeobox protein 3/4
Organism
cdk  Camelus dromedarius (Arabian camel)
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cdk03000]
    105099988 (LHX4)
Transcription factors [BR:cdk03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain with LIM region
    105099988 (LHX4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain LIM Homeobox_KN PHF5
Motif
Other DBs
NCBI-GeneID: 105099988
NCBI-ProteinID: XP_031291519
Position
21
AA seq 329 aa AA seqDB search
MQLADRCFSRAGSVYCKEDFFKRFGTKCTACQQGIPPTQVVRKAQDFVYHLHCFACIICS
RQLATGDEFYLMEDGRLVCKEDYETAKQNDDSEAGAKRPRTTITAKQLETLKNAYKNSPK
PARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLKKDAGRHRWGQFYKSVKRSRGGSKQE
KESSAEDCGVSDSELSFREDQILSELGHTNRIYGNVGDVTGGQLMNGSFSMDGTGQSYQD
LRDGSPYGIPQSPSSISSLPSHAPLLNGLDYTVDSNLGIIAHAGQGVSQTLRAMAGGPTS
DISTGSSVGYPDFPTSPASWLDEMDHPPF
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgcagctggctgacaggtgcttctccagggccgggagtgtctactgcaaagaggacttc
ttcaagcgcttcggcacaaaatgcacggcctgccagcagggcatccccccgacccaggtg
gtccgcaaggcgcaggacttcgtctaccacctgcactgcttcgcctgcatcatctgtagc
cggcagctggccacgggggacgagttctacctcatggaggacgggcggctggtgtgcaag
gaggactacgagacggccaagcagaacgatgactcagaggccggagctaagcggccgcgg
accaccatcacagcgaagcagctggagacgctgaagaacgcctacaagaactcccccaag
cctgcgcgacacgtgagggagcagctgtcctcggagacaggcctggacatgagggtggta
caggtttggtttcagaacagaagggccaaggagaagcggctgaagaaggacgcggggcga
caccgctgggggcagttctacaagagcgtcaagcggagccggggaggcagcaagcaggag
aaggagagctctgcggaggactgtggggttagtgacagtgagctgagcttccgagaggat
caaatactctcagaacttggccacaccaataggatttatggcaacgtgggggacgttaca
ggcggacagttaatgaatgggagcttctccatggacgggacaggacaatcctatcaggac
ttgagggatgggagcccctatggaatcccccagtctccatcctccatatcgtccctgcca
tcccacgctcctttgctcaatgggctggattacacggtggacagtaatttgggcatcatt
gcgcatgcagggcagggagtaagccagacgctgagagccatggctgggggaccgacctct
gacatctccacaggaagcagtgtaggctaccccgactttccaactagcccagcctcttgg
ctcgatgaaatggatcatcctcctttttaa

DBGET integrated database retrieval system