KEGG   Camelus dromedarius (Arabian camel): 105100091Help
Entry
105100091         CDS       T04642                                 

Gene name
TGFB2
Definition
(RefSeq) transforming growth factor beta 2
  KO
K13376  transforming growth factor beta-2
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04010  MAPK signaling pathway
cdk04060  Cytokine-cytokine receptor interaction
cdk04068  FoxO signaling pathway
cdk04110  Cell cycle
cdk04218  Cellular senescence
cdk04350  TGF-beta signaling pathway
cdk04380  Osteoclast differentiation
cdk04390  Hippo signaling pathway
cdk04933  AGE-RAGE signaling pathway in diabetic complications
cdk05140  Leishmaniasis
cdk05142  Chagas disease (American trypanosomiasis)
cdk05144  Malaria
cdk05145  Toxoplasmosis
cdk05146  Amoebiasis
cdk05152  Tuberculosis
cdk05161  Hepatitis B
cdk05166  Human T-cell leukemia virus 1 infection
cdk05200  Pathways in cancer
cdk05205  Proteoglycans in cancer
cdk05206  MicroRNAs in cancer
cdk05210  Colorectal cancer
cdk05211  Renal cell carcinoma
cdk05212  Pancreatic cancer
cdk05220  Chronic myeloid leukemia
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
cdk05321  Inflammatory bowel disease (IBD)
cdk05323  Rheumatoid arthritis
cdk05410  Hypertrophic cardiomyopathy (HCM)
cdk05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105100091 (TGFB2)
   04350 TGF-beta signaling pathway
    105100091 (TGFB2)
   04390 Hippo signaling pathway
    105100091 (TGFB2)
   04068 FoxO signaling pathway
    105100091 (TGFB2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    105100091 (TGFB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    105100091 (TGFB2)
   04218 Cellular senescence
    105100091 (TGFB2)
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    105100091 (TGFB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105100091 (TGFB2)
   05206 MicroRNAs in cancer
    105100091 (TGFB2)
   05205 Proteoglycans in cancer
    105100091 (TGFB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    105100091 (TGFB2)
   05212 Pancreatic cancer
    105100091 (TGFB2)
   05225 Hepatocellular carcinoma
    105100091 (TGFB2)
   05226 Gastric cancer
    105100091 (TGFB2)
   05220 Chronic myeloid leukemia
    105100091 (TGFB2)
   05211 Renal cell carcinoma
    105100091 (TGFB2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    105100091 (TGFB2)
   05321 Inflammatory bowel disease (IBD)
    105100091 (TGFB2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    105100091 (TGFB2)
   05414 Dilated cardiomyopathy (DCM)
    105100091 (TGFB2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    105100091 (TGFB2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    105100091 (TGFB2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105100091 (TGFB2)
   05161 Hepatitis B
    105100091 (TGFB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    105100091 (TGFB2)
   05144 Malaria
    105100091 (TGFB2)
   05145 Toxoplasmosis
    105100091 (TGFB2)
   05140 Leishmaniasis
    105100091 (TGFB2)
   05142 Chagas disease (American trypanosomiasis)
    105100091 (TGFB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cdk04052]
    105100091 (TGFB2)
   00536 Glycosaminoglycan binding proteins [BR:cdk00536]
    105100091 (TGFB2)
Cytokines and growth factors [BR:cdk04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   105100091 (TGFB2)
Glycosaminoglycan binding proteins [BR:cdk00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   105100091 (TGFB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta SPEG_u2
Motif
Other DBs
NCBI-GeneID: 105100091
NCBI-ProteinID: XP_010991329
Position
Un
AA seq 442 aa AA seqDB search
MHYCVLSAFLILHLVTVALSLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEDYPEP
EEVPPEVISIYNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDMPPFYPSETVCPV
VTTPSGSVGSLCSRQPQVLCGYLDAIPPTFYRPYFRIVRFDVSAMEKNASNLVKAEFRVF
RLQNPKARVAEQRIELYQILKSKDLTSPTQRYIDSKVVKTRAEGEWLSFDVTDAVHEWLH
HKDRNLGFKISLHCPCCTFVPSNNYIIPNKSEELEARFAGIDGTSTYTSGDQKTIKSTRK
KNSGKTPHLLLMLLPSYRLESQPSNRRKKRALDAAYCFRNVQDNCCLRPLYIDFKRDLGW
KWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILY
YIGKTPKIEQLSNMIVKSCKCS
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgcactactgtgtgctgagcgcttttctgatcctgcatctggtcacggtcgcgctcagc
ctgtctacctgcagcacgctcgacatggaccagttcatgcgcaagaggatcgaggcgatc
cgcgggcagatcctgagcaagctgaagctcaccagccccccagaagactaccccgaaccc
gaggaggtccccccggaggtgatttccatctacaacagcaccagggacttgctccaggag
aaggcgagccggagggcggccgcctgcgagcgcgagcggagcgacgaggagtactacgcc
aaggaggtttacaaaatagacatgccgcccttctacccctcggaaactgtctgcccagtt
gttacaacaccctctggctcagtgggcagcttgtgctccagacagccccaggtgctctgt
gggtaccttgatgccatcccgcccactttctacagaccctacttcagaattgtccgattt
gacgtctcagcgatggagaagaatgcttccaatttggtgaaggccgagttcagagtcttt
cgtttacagaaccccaaggccagagtcgcggaacaacggatcgagctgtatcagattctc
aaatccaaagatttaacgtctccaacccagcgctacatcgacagcaaagtcgtgaaaacg
agagcggaaggtgaatggctgtcctttgatgtcacggatgctgttcacgaatggctccac
cataaagataggaacctgggatttaagataagtttacactgtccttgctgcacctttgta
ccatctaataattacatcatccccaataaaagtgaagaactagaagcacgatttgcaggt
attgatggcacctccacatataccagtggtgatcagaaaactataaagtccactaggaaa
aaaaacagtgggaagaccccacatctcctgctaatgttgttgccctcctacagacttgag
tcgcaaccatccaaccggcggaagaagcgtgctttggatgcagcttattgctttagaaat
gtgcaggataattgctgcctgcgtccactttacattgatttcaagagggatcttgggtgg
aaatggatacatgaacccaaagggtacaatgctaacttctgtgccggagcctgcccgtat
ctgtggagctcagacactcagcacagcagggttctcagcttatataataccataaatcca
gaagcatctgcctccccttgctgcgtgtcccaggatttagaaccgctaaccattctctac
tacatcggcaaaacacccaagatcgaacagctttccaacatgatcgtaaagtcttgtaaa
tgcagctaa

DBGET integrated database retrieval system