KEGG   Camelus dromedarius (Arabian camel): 105100895
Entry
105100895         CDS       T04642                                 

Gene name
ERAP1
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
cdk  Camelus dromedarius (Arabian camel)
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cdk01002]
    105100895 (ERAP1)
Enzymes [BR:cdk01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     105100895 (ERAP1)
Peptidases and inhibitors [BR:cdk01002]
 Metallo peptidases
  Family M1
   105100895 (ERAP1)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N DUF4003
Other DBs
NCBI-GeneID: 105100895
NCBI-ProteinID: XP_010992269
Position
3
AA seq 937 aa
MIAQSIKWPLATMSLLLLLTVSNPSWCQSSETSAPKASDGAPFPWNKMRLPEHIIPVHYD
LMIHANLTTLTFEGTTEIEITASKPTSTIILHSHRLRISQATLRRGAAEGQSELPLRVLE
YPPQEQIALLAPEPLGVGVPYTVVIAYASSLSESFHGFYKSTYRTKEGKVRILASTQFEP
TAARMAFPCFDEPAFKASFSVKIRREPRHLAISNMPLVKSVTIAEGLIEDHFDVTVKMST
YLVAFIVSDFKSVSKMTKSGVKVSVYAVPDKINQADYALDAAVTLLEFYEDYFSIPYPLP
KQDLAAIPDFQFGAMENWGLTTYRESSLLFDAEKSSASSKLGITMTVSHELAHQWFGNLV
TMEWWNDLWLNEGFAKFMEFVSVSVTHPELKVEDYFLGKCFDVMEVDALNSSHPVSTPVE
NPAQIREMFDDVSYEKGACILNMLRDYLSADAFKSGIVKYLQKYSYKNTKNEDLWNSMAT
ICPTDGTQRMDGFCSRGEHSSSSAHWRQEGLDVKTMMNTWTLQKGFPLITIAVRGRNVHM
KQEHYVKGLDDAPETGYLWHVPLTFITSKSDSVQRFLLKTKTDVLILPEEVEWIKFNVGM
NGYYIVHYEDDGWDSLTGLLKGTHTAISSNDRASLINNAFQLVSIGKVSIEKALDLTLYL
KRETEIMPVFQGMNELIPMYKLMEKRDMDEVETQFKAFLIRLLRDLIDKQTWTDEGSVSE
RLLRSQLLLLACLRKYQPCVQRAEAYFKEWKEANGNLSLPNDVTLAVFAVGAQNPEGWDF
LYSKYQSSLSSTEKNQIEFALCISQNKEKLQWLLEQSFKGDVIKTQEFPDILRAIGRNPV
GYPLAWKFLRENWNNLVQKFELGSSSIASMVVGTTNQFSTRARLEEVKEFFSSLKENGSQ
LRCVQQTIETIEENIRWMDKNFDKIRVWLQNEKLELL
NT seq 2814 nt   +upstreamnt  +downstreamnt
atgatagctcagtccatcaagtggccactggcaaccatgtcgctgttgcttctcttaact
gtgtcaaatccatcctggtgtcagagcagtgaaacttcagctcccaaagctagtgatggg
gctccatttccttggaataaaatgcgacttcctgagcacatcatcccagttcattacgat
ctcatgatccacgcaaatctcaccactctgactttcgagggaaccacggaaatagaaatc
acagccagcaagcccaccagtaccatcatcctgcatagtcaccgcctgcgcatatcgcag
gccaccctgaggaggggagctgcagaggggcagtctgaattgccactgagagtcctggaa
tatccacctcaagagcaaatcgcgctcctggctcccgagccgctgggtgttggagtcccg
tacaccgttgtcattgcctatgccagcagtctttctgagagtttccatgggttttacaaa
agcacctacaggaccaaggaagggaaagtgaggatacttgcatcaacacaatttgaacct
actgcagccagaatggcctttccctgctttgatgaacctgctttcaaagcgagtttttca
gtgaagatcagaagggaaccaagacacctcgccatctccaatatgccattggttaaatct
gtgactattgctgaaggactcatagaagaccattttgatgtcactgtgaagatgagcacc
tacctggtggccttcattgtctcagattttaagtctgtcagcaagatgaccaagagtgga
gtcaaggtttccgtgtatgctgttccagacaaaataaatcaggcagattatgcactggat
gctgcagtgactcttctagaattttatgaggattatttcagcattccatatcccttaccc
aaacaagatcttgctgctattcctgactttcagtttggtgctatggaaaactggggactg
acaacatacagggaatcatcattactgtttgatgctgagaagtcttctgcatcaagtaag
cttggcatcacgatgacggtgtcccatgaacttgcccaccagtggttcgggaaccttgtc
actatggaatggtggaatgatctttggctaaatgagggatttgccaagtttatggagttc
gtttctgtcagtgtgactcatccagaactgaaagttgaggattatttccttggtaagtgt
tttgatgtgatggaggtagatgcattaaattcctcacaccctgtgtccacacctgtggag
aatcctgctcagattcgggagatgtttgatgacgtttcatatgaaaagggtgcttgtatt
ctgaatatgctcagggattatcttagtgctgatgcatttaaaagtggtattgtaaagtat
ctgcagaagtatagctataaaaacacaaaaaacgaggacctgtggaatagcatggcgact
atttgccctacagatggtacacaaaggatggatggcttttgttctagaggtgaacattca
tcttcatctgcacactggcgacaggagggccttgatgtgaaaaccatgatgaacacctgg
acactgcagaagggctttcccctgataaccatcgcagtgagagggaggaacgtccacatg
aagcaggagcactacgtgaagggactggatgatgccccggaaactgggtacctgtggcat
gttccattgacattcattaccagcaaatcagactcagtccaaagatttttgctgaagaca
aaaacagatgtgctcatccttccagaagaggtggaatggatcaaatttaatgtgggaatg
aatggctattacatcgtgcattatgaggatgatggatgggattctctgactggcctttta
aaaggaacacacacggcaatcagcagtaacgatcgggccagtctcattaacaatgcattt
cagcttgtcagcattggaaaggtatcaattgaaaaagccttggatttaaccctgtacttg
aaacgtgaaactgaaattatgccggtgttccaaggtatgaatgagctgatacctatgtat
aagttaatggagaagagagatatggatgaagtggaaacgcaattcaaggcctttctcatc
aggctactgagggacctcattgataagcagacgtggacggacgagggctccgtctcagag
cgactgctgcggagtcagctgctcctcctggcctgcctgcgcaagtatcagccctgcgtg
cagagggcagaagcctatttcaaagaatggaaggaagccaatggaaacttgagcctgccc
aatgatgtgaccttggccgtgtttgctgtgggggcccagaaccctgaaggatgggacttt
ctttatagtaaatatcagtcatcattgtccagtaccgagaaaaaccaaattgaatttgct
ctctgtattagtcaaaataaagaaaagcttcagtggctactagagcaaagttttaaggga
gatgtaataaaaactcaagagtttccagatattcttagagctattggcagaaacccggtg
ggatatccattggcctggaagtttctgagggaaaattggaataatcttgtacaaaagttt
gaacttggctcgagttccatagcctccatggttgtgggaacaacaaaccaattctccacg
agagcacggcttgaagaggtaaaagaattcttcagctctttgaaggaaaatgggtctcag
ctccgttgtgtccaacaaacaatcgaaaccattgaggaaaacatacgttggatggataag
aattttgataaaatcagagtgtggctacaaaatgaaaagcttgaactgttgtaa

DBGET integrated database retrieval system