KEGG   Camelus dromedarius (Arabian camel): 105101057Help
Entry
105101057         CDS       T04642                                 

Gene name
SLC4A1
Definition
(RefSeq) solute carrier family 4 member 1 (Diego blood group)
  KO
K06573  solute carrier family 4 (anion exchanger), member 1
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04966  Collecting duct acid secretion
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    105101057 (SLC4A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cdk02000]
    105101057 (SLC4A1)
   04147 Exosome [BR:cdk04147]
    105101057 (SLC4A1)
   04090 CD molecules [BR:cdk04090]
    105101057 (SLC4A1)
Transporters [BR:cdk02000]
 Solute carrier family (SLC)
  SLC4: Bicarbonate transporter
   105101057 (SLC4A1)
Exosome [BR:cdk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   105101057 (SLC4A1)
CD molecules [BR:cdk04090]
 Proteins
  105101057 (SLC4A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HCO3_cotransp Band_3_cyto
Motif
Other DBs
NCBI-GeneID: 105101057
NCBI-ProteinID: XP_010992463
Position
Un
AA seq 795 aa AA seqDB search
MDEKNQELQWMEAARWLHMEENRGKDGTWGRPHVSYLTFWSLLELQKAFAKGTVLLDLPE
KSLAGVVSQLLDRFIFDGQIQRQDRETLLRALLLKHSHARDTDALGGMKPTVLTRSGKAS
QPLLPQRPQMEEKLFCEQRKIPQDSEGALVLTSWSGLCWAPIMDYSQLGRAAATLMSERV
FRIDAYLAQSKETLVHSLEGFLDCSLVLPPSDAPSEKALRSLLPVQMELLRRRLSSSAKP
EPNLHEDEDISGDPLRRTGRLFGGLVRDIRRRYPRYLSDISDALSPQVLAAVIFIYFAAL
SPAITFGGLLGEKTQNLMGVSELLISTAVQGILFSLLGAQPLLVVGFSGPLLVFEEAFFS
FCTRNNLEYIVGRVWIGFWLILLVVLVVAFEGSFLVRFISRYTQEIFSILISLIFIYETF
AKLVQIFQDHPLQRNYDQNVVMIPKPQAPLPNTALLSFVLMAGTFFFAMVLRKFKNSAYF
PGKLRRVIGDFGVPISILIMVMVDALIQDTYTQKLSVPKGLALSNSSARGWFINPLGLRS
EFPIWMMFASLLPAMLVFILIFLESQITTLIISKPERKLVKGSGFHLDLLLIMGMGGVAA
LFGMPWLSATTVRSVTHANALTVMSKPRSPGATAQIQEVKEQRISGLLVAVLVGLSVLMW
PILSYIPLAVLFGIFLYMGVTSLSGIQLFDRVLLLFKPRKYHPDVPYVKRVKTLRMHLFT
GIQILCLIVLWVVKSIGIISLALPFILILTVPLRRFLLPLIFRDVELQCLDADNAKPNFD
EESGQDEYDEVTMPV
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atggatgaaaagaaccaggagctgcaatggatggaggcagcgcgctggctgcacatggag
gagaaccgggggaaggatggaacctggggccgcccacacgtgtcttacctcaccttctgg
agcctcttggagctgcagaaagccttcgccaagggtactgtcctcctggacctgccagag
aaatccctggctggggtggtcagccagctgctggacaggtttatcttcgacgggcagatc
cagcgtcaggaccgagagaccctgcttcgggccttgctccttaaacacagccacgccaga
gacaccgatgccctggggggcatgaagcccacggtcctgacacgttctgggaaagcttca
cagcctctgctcccacaacgtccccagatggaggaaaaactcttctgtgaacagagaaag
attccccaggattcggagggcgccctggtgctaacttcctggagcggcctgtgctgggcc
cccatcatggactactcccagctgggtcgggccgctgccaccctcatgtcggagagggtg
ttccgaattgatgcatacttagcccagagcaaggagacgctggtacactccctggagggc
ttcctagactgtagtctggtgctgcctccatcggatgctccctccgagaaggccctgcgc
agtctgctgcctgtgcagatggaactgctgcggagacgcctgtccagctctgccaagcca
gaacccaatttacatgaagatgaagatatctcaggtgaccctctgcggcggacaggcagg
ctcttcggagggttggtgcgtgacatccgtcgccgctatccccgctacttgagtgacatc
tcagatgcattgagcccccaggtcctggctgctgtcatcttcatctactttgctgccctg
tcacccgccatcacctttggcggcctcctcggagaaaagacccagaacctgatgggggtg
tcggaactgctcatctccaccgcggtgcagggcatcttgttctccctgctgggggctcag
cccctgcttgtggtgggcttctcaggacccctgctcgtgtttgaggaagccttcttctcg
ttctgcaccaggaacaacctggagtacattgtaggccgtgtgtggattggcttctggctc
atcctgctggtggtgctggtggtggccttcgagggcagcttcctggtccgcttcatctcc
cggtatacacaggagatcttctccatcctcatctccctcatcttcatctatgagaccttc
gcaaagctggtccagatcttccaggaccacccactgcagaggaattatgaccaaaatgta
gtaatgatacccaaacctcaggctcccctgcccaacacagccctcctctcttttgtgctc
atggctggcaccttcttcttcgccatggtgctacgcaagttcaagaacagcgcctacttc
cctggcaagctgcgacgggtcatcggggactttggggttcccatctctatcctgatcatg
gtcatggtggatgccctcatccaggacacttacactcagaaactcagcgtacctaaaggc
cttgccttatccaactcctcggcccggggctggttcatcaacccgctgggtttgcgatcc
gaatttcccatctggatgatgtttgcttccttgctgcctgccatgctggtcttcatcctc
atcttcctagagtcccagatcaccacgctgatcatcagcaaaccggagcgcaagctggtc
aagggttctggtttccacctggatctgctgctgatcatgggcatgggtggggtggccgcc
ctctttgggatgccctggctcagtgccaccactgtgcgttctgtcacccacgccaatgcc
ctcactgtcatgagcaagcccagatccccaggggctacagctcagattcaggaagtcaag
gaacagcggataagcgggctcctggtcgctgtgctagtgggcctgtctgtcctcatgtgg
cccatcctgtcctacatccccctggctgttctgtttggcatcttcctctacatgggggtc
acatccctcagtggcatccagctcttcgaccgcgtcttgcttctgttcaagccgagaaag
taccacccggatgtgccctatgtcaagcgggtaaaaaccttgcgcatgcacttgtttacg
ggcatccagatcctctgcctgatagtgctgtgggtggtaaagtccatcgggatcatctcg
ctggccctgcccttcatcctcatcctcacggtgcccctacgccgcttcctgctgccgctc
atcttccgggatgtggagctccagtgtctggatgctgacaatgccaagccgaactttgat
gaggagagtggccaggatgaatatgatgaggtgaccatgcctgtgtga

DBGET integrated database retrieval system