KEGG   Camelus dromedarius (Arabian camel): 105101745Help
Entry
105101745         CDS       T04642                                 

Gene name
PLA2G4E
Definition
(RefSeq) phospholipase A2 group IVE
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk00564  Glycerophospholipid metabolism
cdk00565  Ether lipid metabolism
cdk00590  Arachidonic acid metabolism
cdk00591  Linoleic acid metabolism
cdk00592  alpha-Linolenic acid metabolism
cdk01100  Metabolic pathways
cdk04010  MAPK signaling pathway
cdk04014  Ras signaling pathway
cdk04072  Phospholipase D signaling pathway
cdk04217  Necroptosis
cdk04270  Vascular smooth muscle contraction
cdk04370  VEGF signaling pathway
cdk04611  Platelet activation
cdk04664  Fc epsilon RI signaling pathway
cdk04666  Fc gamma R-mediated phagocytosis
cdk04724  Glutamatergic synapse
cdk04726  Serotonergic synapse
cdk04730  Long-term depression
cdk04750  Inflammatory mediator regulation of TRP channels
cdk04912  GnRH signaling pathway
cdk04913  Ovarian steroidogenesis
cdk04921  Oxytocin signaling pathway
cdk05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    105101745 (PLA2G4E)
   00565 Ether lipid metabolism
    105101745 (PLA2G4E)
   00590 Arachidonic acid metabolism
    105101745 (PLA2G4E)
   00591 Linoleic acid metabolism
    105101745 (PLA2G4E)
   00592 alpha-Linolenic acid metabolism
    105101745 (PLA2G4E)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    105101745 (PLA2G4E)
   04010 MAPK signaling pathway
    105101745 (PLA2G4E)
   04370 VEGF signaling pathway
    105101745 (PLA2G4E)
   04072 Phospholipase D signaling pathway
    105101745 (PLA2G4E)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    105101745 (PLA2G4E)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    105101745 (PLA2G4E)
   04664 Fc epsilon RI signaling pathway
    105101745 (PLA2G4E)
   04666 Fc gamma R-mediated phagocytosis
    105101745 (PLA2G4E)
  09152 Endocrine system
   04912 GnRH signaling pathway
    105101745 (PLA2G4E)
   04913 Ovarian steroidogenesis
    105101745 (PLA2G4E)
   04921 Oxytocin signaling pathway
    105101745 (PLA2G4E)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    105101745 (PLA2G4E)
  09156 Nervous system
   04724 Glutamatergic synapse
    105101745 (PLA2G4E)
   04726 Serotonergic synapse
    105101745 (PLA2G4E)
   04730 Long-term depression
    105101745 (PLA2G4E)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    105101745 (PLA2G4E)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    105101745 (PLA2G4E)
Enzymes [BR:cdk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     105101745 (PLA2G4E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: cPLA2_C2 PLA2_B C2 CEP76-C2
Motif
Other DBs
NCBI-GeneID: 105101745
NCBI-ProteinID: XP_010993285
Position
Un
AA seq 863 aa AA seqDB search
MALQASEGQPGLETNVFVPQSLQGDEEDSMSGRTVSELEHTQVLETPDLPPLLPVAPGGS
QEELSPCHLLTVRVVRMKNVRQADLVSQTDCFVSLWLPTASCKRLRTRTISNCPNPEWNE
TFNFQIQSRVKNVLELSVCDEDTMTPDDHLLTVLYDLTKLCFRKKTHLKFPLNPEGMEEL
EVEFLLEESPSPPESLITNGVLVSRQMSCLEVHAESRRQKKNRKRTDFLVTVTQSFEHTQ
RISCSQEPCCPNPACFHYPKYFQPQVHVEVPKSQWSCKLCCCCAHKNSPVCQPLDCLPDG
QTVNLPVSENCELHMKSTPCSQTLDVRLGFSLCQAEQEFLQKRRVVVAEALKQVLQLEED
LQVDEVPLIAIMATGGGTRSMTAMYGHLLGLQKLNILNCASYITGLSGATWTMATLYRDP
DWSSKNLEPAIFEARRHVVKDKLPALYPDQLLKFREELQQRRQEGYKVTFTDFWGLLIEA
CLGDERNECKLSEQRAALCQGQNPLPIYLTINVKDDVSNQDFREWCEFSPYEVGLQKYGA
FIPTELFGSEFFMGRLMRRIPESRMCYMLGLWSSIFSLNLLDAWNLSHTSEEFFYKWTRE
RVHDIEDEPLLPEIPKCDANVLETTVVTPASWLSNTFRTILTYRSFVSEFHNFLLGLQLH
TDYLQSSEFSKWKDTVLDSFPNQLTPSVNHLCLLDTAFFVNSSYPPLLRPERKVDLIIHL
NYCAGSQTKPMKQTCEYSTVQNIPFPKYELQEEDDKLKECYLMENSQEPDAPTVVFFPLI
NDTFQKYKAPGVERSPEELEQGQVDIYGPKTPYATKELTYTEAAFDKLVKLSEYNILNNK
DKLLEALRLAVEKKKRLKGQGPS
NT seq 2592 nt NT seq  +upstreamnt  +downstreamnt
atggctctccaggcctcagaaggccagccaggcctggaaactaatgtgtttgtcccgcag
agcctgcaaggggatgaggaagacagcatgtcagggagaaccgtcagtgagctggagcac
acacaggtcctggagactcccgatctcccacctctacttcccgtggcccctgggggctct
caggaggagctgtctccatgccacctgctgacagtgagggtcgtccggatgaaaaacgtc
cgacaggctgatttggtgagccaaacagactgttttgtgagcctctggctgcccaccgcc
tcttgtaagaggctgaggactcggaccatctccaactgcccaaatccagagtggaatgag
accttcaacttccagatccagagccgagtgaagaacgtgctagagctgagcgtctgtgat
gaagacacaatgacaccagatgaccatctcttgacagttctctatgacctcaccaagctc
tgcttccgaaagaaaacccacctgaagttcccactcaacccagagggcatggaggagctg
gaggtggagttcctgctagaagagagtccctctccacctgagagcctcatcaccaacggc
gtgctggtgtctcgacaaatgtcctgcctggaggttcatgcagaatccaggaggcagaag
aagaataggaaaaggacggacttcctggtgacagtgacgcagtccttcgagcacacccag
cgcatctcatgcagccaggagccctgctgcccaaatcctgcctgcttccactaccccaag
tacttccagccccaggtacacgtggaggtgcccaagagccagtggagctgcaagctttgc
tgctgctgtgcgcacaagaacagccctgtctgccagccccttgattgcctccccgatggc
cagacagtgaacctgcctgtgagcgagaactgtgaattgcacatgaagtctacaccctgc
tcccagacgctggacgtgcggctgggcttcagcctgtgccaggcagagcaggagttcctg
cagaagcggagggtggtggtggccgaggcactgaagcaggtgttgcagctggaggaggac
ctgcaggtggacgaggtaccactgatagccatcatggccactgggggtggaacgagatcc
atgaccgccatgtacggccacctgctcgggctgcagaagctgaacatcctcaactgtgcc
agctacatcactggcctgtcaggggccacctggaccatggctaccttgtaccgtgaccct
gactggtcctccaaaaacctggagcctgccatctttgaggcgcggaggcacgtagtcaag
gacaagctgcctgccctgtatccagaccagctcttgaaattccgggaggagcttcagcag
cgcaggcaggaaggctacaaggtcacctttacagacttctggggcctgctgattgaggcc
tgtctgggggacgagagaaatgaatgcaaactttcagagcagcgtgctgctttgtgccag
ggccagaaccccctccccatctacctcaccatcaatgtcaaggatgatgtaagcaaccag
gatttcagagagtggtgcgagttctctccctacgaggtgggcctgcagaagtacggcgcc
ttcatccccaccgagctctttggctccgagttcttcatggggcggctgatgaggaggatc
ccagagtcccgaatgtgctacatgctaggtttgtggagcagcatcttctccctgaacctg
cttgatgcctggaatctgtcccatacctcggaggagtttttctacaagtggacaagggag
agagtgcacgatattgaagatgagccgctcctgcctgaaatccctaaatgtgatgccaat
gtcctggaaaccacagtggtgacaccggcatcctggctgtccaatactttccgcaccatc
ctcacctatcgatccttcgtgtctgagttccacaacttcctgctgggactgcagctgcac
actgactacctccagagcagcgagttctccaagtggaaagacacggtgctggacagcttc
ccaaaccagctgacaccatccgtgaaccatttgtgcctgctggacactgcgttctttgtc
aactccagctacccgcccctcctcaggcctgagagaaaagttgacctcatcatccacctc
aattactgtgcggggtcccagacaaagcccatgaaacaaacgtgcgagtactccactgtg
cagaacatcccctttcccaaatatgagctgcaggaggaggatgataagctgaaggagtgc
tacctgatggagaactcccaggaacctgatgcccccactgtggttttcttcccactcatc
aatgacaccttccaaaagtacaaggccccaggtgtggagcgaagccccgaggagctggag
cagggccaggttgacatctatggtcccaaaactccctacgccaccaaggaactgacatac
acggaggccgcctttgacaagctggtgaagctctccgagtacaacatcctgaataacaag
gacaagctccttgaggccttgagactggcggtggagaagaagaaacgcctgaagggccag
ggtccttcttaa

DBGET integrated database retrieval system