KEGG   Camelus dromedarius (Arabian camel): 105101880Help
Entry
105101880         CDS       T04642                                 

Gene name
FKBP8
Definition
(RefSeq) FK506 binding protein 8
  KO
K09574  FK506-binding protein 8 [EC:5.2.1.8]
Organism
cdk  Camelus dromedarius (Arabian camel)
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cdk01009]
    105101880 (FKBP8)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:cdk03110]
    105101880 (FKBP8)
Enzymes [BR:cdk01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     105101880 (FKBP8)
Protein phosphatases and associated proteins [BR:cdk01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     105101880 (FKBP8)
Chaperones and folding catalysts [BR:cdk03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    105101880 (FKBP8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C TPR_1 TPR_2 Fis1_TPR_C TPR_14 TPR_11 TPR_7 TPR_16 TPR_8 TPR_19 TPR_9 TPR_12 TPR_6 TPR_10 ANAPC3
Motif
Other DBs
NCBI-GeneID: 105101880
NCBI-ProteinID: XP_010993437
Position
Un
AA seq 413 aa AA seqDB search
MASCAEPSAVGPEPIAPPPAGVPPLEDFEVLDGVEDAEGEEEEEEDLSELPPLEDVGQPP
VEEAEQPGALAREFLASMEPEPEPAPAPDEWLDILGNGLLRKKTLVPGPPGSSRPAKGQV
VTVQLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQ
GSRSPYIPPHAALCLEVTLKTAVDGPDLEMLTGQERVALANRKRECGNAHYQRADFVLAA
NSYDLAIKAITSSAKVDMTFEEEEQLLQLKVKCLNNLAASQLKLDHYRAALRSCSLVLEH
QPDNINIKALLRKGKVLAQQGEYSEAIPILRAALKLEPSNKTIHAELSKLVKKHAAQRST
ETALYRKMLGNPSRLPAKCPGKGAWSIPWKWLFGATAVALGGVALSVVIAARN
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggcatcctgtgctgagccctctgctgtgggccctgagcccattgcccctccacctgct
ggggtcccaccacttgaggacttcgaggtactggatggggtggaagacgcagagggcgag
gaggaggaagaggaggacctgagtgagctaccgccacttgaagatgtggggcagccccca
gtggaggaggccgaacagcctggggccttggcccgagagttcctggcctccatggagcct
gagcctgagccggccccggccccggacgagtggctggacatcttggggaacgggctattg
aggaagaagacgctggttccagggccaccaggctcaagccgcccggccaagggccaggtg
gtcactgtgcagctgcagacatcgctggagaatggcacgcgggtacaggaggagccagag
ctggtgttcaccctgggcgactgtgacgtcatccaggccctggatctcagtgtcccgctc
atggacgtgggggagacggctatggtcactgctgactccaagtactgctatggcccccag
ggcagcaggagcccgtacatccccccacacgcggccctgtgcctggaggtgaccctgaag
actgccgtggatgggcctgacctagagatgctcacggggcaggagcgtgtggccctggcc
aaccggaagcgggagtgtggcaatgctcactaccagcgggccgactttgtgctggctgcc
aactcctacgacctcgccatcaaggccatcacctctagcgccaaagtggacatgacattt
gaggaggaggagcagctcctgcagctgaaggtgaagtgtctgaacaacttggcagcctca
cagctgaagctggatcactaccgtgcagcactgcgctcctgcagccttgtgctcgagcac
cagcccgacaacataaacatcaaggcgctcctccgcaagggcaaggtgctggcccagcaa
ggcgagtacagtgaggccatccccatcctgagggcagccctgaagctggaaccttccaac
aagacgatccacgcagagctctcgaagctggtgaagaagcatgcggcccagcggagcacg
gagaccgccctgtaccggaagatgttaggcaaccccagccggctgcctgccaaatgtcct
ggcaagggtgcctggtccatcccatggaagtggctgtttggggcaactgcggtcgccttg
gggggtgtggctctctctgtggtcatcgctgccaggaactga

DBGET integrated database retrieval system