KEGG   Camelus dromedarius (Arabian camel): 105101995Help
Entry
105101995         CDS       T04642                                 

Gene name
GATC
Definition
(RefSeq) glutamyl-tRNA amidotransferase subunit C
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk00970  Aminoacyl-tRNA biosynthesis
cdk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    105101995 (GATC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cdk03029]
    105101995 (GATC)
Enzymes [BR:cdk01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     105101995 (GATC)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     105101995 (GATC)
Mitochondrial biogenesis [BR:cdk03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    105101995 (GATC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glu-tRNAGln
Motif
Other DBs
NCBI-GeneID: 105101995
NCBI-ProteinID: XP_010993565
Position
Un
AA seq 139 aa AA seqDB search
MWARAACLGLRASAAARRRGFTSAGADPQGSGRVTAELIEHLERLALVDFGSQEAVARLE
KAIAFADRLRAVDTDGVEPMESVLEDRCLYLRSDNVVEGNCVEELLQNSHRVVEEYFVAP
PGNISWSKLDEKGPSHTAE
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgtgggcgcgggctgcgtgcctgggccttcgggcttcggcggcggcccggcgccggggc
ttcacctccgctggggcggatcctcagggaagtggccgggtcacggccgagctgatcgag
cacctggagcggctcgctcttgtggacttcggcagccaggaggccgtggcgcggctggag
aaagccatcgcctttgccgaccggctccgcgccgtggacacggacggggtggagcccatg
gagtcagtcctggaggacagatgtctgtacttgcgatctgacaatgtggtagaaggcaac
tgtgttgaagaactactacaaaactcccatcgagttgtggaggagtattttgtggccccc
ccaggtaatatctcttggtcaaagctggatgaaaaaggcccttctcacaccgctgagtag

DBGET integrated database retrieval system