KEGG   Camelus dromedarius (Arabian camel): 105102185
Entry
105102185         CDS       T04642                                 

Gene name
AHRR
Definition
(RefSeq) aryl hydrocarbon receptor repressor isoform X1
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
cdk  Camelus dromedarius (Arabian camel)
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cdk03000]
    105102185 (AHRR)
Transcription factors [BR:cdk03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    105102185 (AHRR)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_4 PAS_9
Other DBs
NCBI-GeneID: 105102185
NCBI-ProteinID: XP_031298232
Position
3
AA seq 703 aa
MIPPGECLYAGRKRRKPVQKQRPAVGAEKSNPSKRHRDRLNAELDHLASLLPLPPDIISK
LDKLSVLRLSVSYLRVKSFFQALQERRPQQPAASAPPPGDRGPCGGSAVPEGRLLLESLR
GFALVVSAEGVIFYASATIADYLGFHQTDVMHQNIYDYIHVDDRQDFRRQLHWAMDPPPA
ACGQPLLAETGEDAILGRLLRAQEGGASSPTEYSAFLTRCFVCRVRCLLDSTSGFLTMQF
QGKLKFLFGQKRKAPSGAALPPRLSLFCVAEPVLLPSVAEMKVKSVLLRVKHRGDISATT
DTKAKATGSLCESELYGKPNHLTGRGDGENSISVFRAPVDACCWARVPARVPCLCLRGRP
DLVFDPEGAAGDGGGEALGGLLSGSLGLREQRDTYMSSCRLETLGPTKHLNWKSSQDSGA
KLKLEPSQSDPFSAHTPPHGACLPHPGVQGTIQASSAVAFRNCPGSHPPKHPPGACAGRT
SRALQDGHQGQMHPPASCPFPQGSLDNGHPQPGAQCFPPGGYPTEDKLRGVLMPMGALCN
PMSLDVPIKMESDSGPEDASDGYSVSPGQVWLGAGDVAKRQLATFPSRMHLKTEPDSRHH
LCSPHLGPGMLGAHPRPSRELAPFHPSRCACLGPPARLCVRGHQPPAPGYDGRAPGATPV
VKREPLDSPPWAAPSQGGAPGMFPGSALATRKPPRDSMCAFLP
NT seq 2112 nt   +upstreamnt  +downstreamnt
atgattccgccgggggagtgcttgtatgcggggaggaagaggaggaagcccgttcagaaa
cagaggcctgccgtgggggctgagaagtcaaacccttccaagcggcaccgggaccgcctc
aatgctgagctggaccacctggccagcctgctgccactcccacctgacatcatctctaag
ctggacaagctctcggtcctgcgtctaagtgtcagttacctcagggtgaagagcttcttc
caagccctgcaggagcggcgcccacagcagccggctgccagtgcccccccaccaggagac
agaggtccgtgcggagggtctgccgtgccggagggaaggctgctgctggagtccctccgc
ggcttcgctctggtcgtgagcgccgaaggcgtgatattctacgcgtcagcgacgatcgcg
gactacctgggcttccaccagacagacgtgatgcaccagaacatctacgactacatccac
gtggacgaccgccaggacttccgccggcagctccactgggccatggaccccccaccggca
gcgtgtgggcagcccctgctcgcagagacaggagaggacgccatcctggggaggctgctg
cgggcccaggaggggggcgccagctcgcccacggagtactcggccttcttgacgcgctgc
ttcgtctgccgtgtgcgctgcctgctggacagcacctcgggcttcctgacgatgcagttt
caaggaaaactaaaattcctgtttgggcagaagaggaaggcaccgtcgggcgcagccctg
ccgcctcgcctctccctgttctgtgtggcagagccggtgctcctgccttccgtggcagag
atgaaggtgaagagcgtgcttctgagggtgaagcacagaggggacatctcggccacgacg
gacaccaaagcaaaagctactgggagtctgtgtgaatcagaattgtatggaaaacccaat
catttaacaggaaggggcgatggggaaaacagcatttccgtgttcagggcaccagtggac
gcctgctgctgggcccgggttccagcccgggtcccctgcctgtgcctcaggggccgccca
gatctcgtctttgaccccgagggggctgcaggggacgggggaggagaggcgctcgggggg
ctgctgagcggctccttgggactgagggagcagagagacacgtacatgtccagctgccgc
ctcgagacactaggacccacgaagcacctgaactggaaatccagtcaggacagcggcgct
aagctgaagctggagcccagccagagcgacccgttctctgcacataccccgccccatggc
gcctgcctgcctcacccaggtgtgcagggcaccatccaggccagcagcgctgtggccttc
aggaactgccccggctctcaccccccaaaacatcccccaggtgcctgcgccggccggacc
agcagagccttgcaggatggccatcagggccaaatgcaccctcctgccagctgccccttc
ccccaggggagcctggacaatgggcaccctcagccgggagcacagtgtttcccaccaggt
ggctatcccaccgaggacaagttgcgaggtgtcctgatgcctatgggagccctgtgtaac
cccatgtcactcgatgtgcccatcaagatggagagtgactctgggcccgaggacgcatca
gatggctactctgtgtccccaggccaggtgtggctgggggccggcgatgtggccaagaga
cagctggccactttcccgagcaggatgcacctgaaaacagagccggactccaggcaccac
ctctgcagtccgcacctggggcccggcatgctgggggcccaccctaggcccagcagggag
ctggccccgttccacccctcacgctgcgcctgcctggggcctccagcccgcctctgtgtg
cggggccaccagccccctgctccgggctacgatggcagagctcctggggccacgcctgtc
gtcaagcgcgagcccttggactcgcccccgtgggctgctcccagccagggtggagcgccc
gggatgttccccggcagtgccttggcgacgcggaagccacccagagactccatgtgcgcg
ttcctgccgtag

DBGET integrated database retrieval system