KEGG   Camelus dromedarius (Arabian camel): 105102348Help
Entry
105102348         CDS       T04642                                 

Gene name
TNKS
Definition
(RefSeq) tankyrase
  KO
K10799  tankyrase [EC:2.4.2.30]
Organism
cdk  Camelus dromedarius (Arabian camel)
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cdk03032]
    105102348 (TNKS)
   03036 Chromosome and associated proteins [BR:cdk03036]
    105102348 (TNKS)
Enzymes [BR:cdk01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     105102348 (TNKS)
DNA replication proteins [BR:cdk03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     105102348 (TNKS)
Chromosome and associated proteins [BR:cdk03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Pericentriolar materials (PCM)
    Other PCM proteins
     105102348 (TNKS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_5 Ank_4 Ank Ank_2 Ank_3 PARP SAM_2 SAM_1
Motif
Other DBs
NCBI-GeneID: 105102348
NCBI-ProteinID: XP_010993988
Position
Un
AA seq 1116 aa AA seqDB search
MAGRKSSPLHFAAGFGRKDVVEHLLQMGANVHARDDGGLIPLHNACSFGHAEVVSLLLCQ
GADPNARDNWNYTPLHEAAIKGKIDVCIVLLQHGADPNIRNTDGKSALDLADPSAKAVLT
GEYKKDELLEAARSGNEEKLMALLTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQH
GADVHAKDKGGLVPLHNACSYGHYEVTELLLKHGACVNAMDLWQFTPLHEAASKNRVEVC
SLLLSHGADPTLVNCHGKSAVDMAPTPELRERLTYEFKGHSLLQAAREADLAKVKKTLAL
EIINFKQPQSHETALHCAVASLHPKRKQVTELLLRKGANVNEKNKDFMTPLHVAAERAHN
DVMEVLHKHGAKMNALDTLGQTALHRAALAGHLQTCRLLLSYGSDPSIISLQGFTAAQMG
NEAVQQILSESTPIRTSDVDYRLLEASKAGDLETVKQLCSPQNVNCRDLEGRHSTPLHFA
AGYNRVSVVEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKF
TPLHEAAAKGKYEICKLLLKHGADPTKKNRDGNTPLDLVKEGDTDIQDLLRGDAALLDAA
KKGCLARVQKLCTPENINCRDTQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGL
IPLHNAASYGHVDIAALLIKYNTCVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPTM
KNQEGQTPLDLATADDIRALLIDAMPPEALPTCFKPQATVVSASLISPASTPSCLSAASS
IDNLTGPLAELAVGGAANTADGAAGAERKEGEVAGLDMNISQFLKSLGLEHLRDIFETEQ
ITLDVLADMGHEELKEIGINAYGHRHKLIKGVERLLGGQQGTNPYLTFHCVNQGTILLDL
APEDKEYQSVEEEMQSTIREHRDGGNAGGIFNRYNVIRIQKVVNKKLRERFCHRQKEVSE
ENHNHHNERMLFHGSPFINAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGG
TGCPTHKDRSCYICHRQMLFCRVTLGKSFLQFSTMKMAHAPPGHHSVIGRPSVNGLAYAE
YVIYRGEQAYPEYLITYQIMKPEAPSQTATAAEQKT
NT seq 3351 nt NT seq  +upstreamnt  +downstreamnt
atggccggccggaagtcttctcccctgcacttcgctgcaggttttggaaggaaggatgtc
gtagaacacttactacagatgggtgctaatgtccatgctcgtgatgatggcggtctcatc
ccgcttcataatgcttgttcttttggccatgctgaggttgtgagtctgttactgtgccaa
ggagctgatccaaatgccagggataactggaactatacgcctctgcatgaagctgctatt
aaaggaaagatcgatgtgtgtattgtgctgctgcagcacggagccgatccaaacattcgg
aacactgatgggaaatcagccctggacctggcagatccttcagcaaaagctgtccttaca
ggtgaatacaagaaagacgaactcctagaagctgctaggagtggtaatgaagaaaaacta
atggctctactgactcctctaaatgtgaattgccacgcgagtgatgggcgaaagtcgact
cctttacatctagcagcaggctacaaccgagtccggatagttcagcttcttctccagcat
ggggcggatgtgcatgcaaaagacaaaggtggactagtacctcttcataatgcatgttca
tatggacattatgaagtcacagaactgctattaaagcatggagcttgtgttaatgcaatg
gatctctggcagtttaccccactccatgaggctgcttccaagaatcgtgtagaagtctgc
tcattgttgcttagccatggtgctgatcctacgttagtcaattgccacggcaaaagtgct
gtggatatggctccaacgcctgagctccgggagagactgacttatgaatttaaaggtcat
tctttactgcaagcagccagagaagcagacctagccaaagttaaaaaaacacttgctttg
gaaatcattaatttcaaacaaccacagtctcatgaaactgcactgcactgtgctgtggct
tccctgcatcccaaacgcaaacaagtgacagaattgttacttagaaaaggagcaaatgtt
aatgaaaaaaataaagatttcatgactcccctgcatgttgcagcagaaagagctcacaat
gatgtcatggaagttctacataagcatggagcaaagatgaatgcactggacacccttggt
cagaccgctttgcatagagccgccctagccggtcacctgcagacctgccgcctcctgctg
agttatggctctgatccctccatcatctccttacaaggctttacagcagcgcagatgggg
aatgaagccgtgcagcagattctgagtgaaagtacgcctatacgcacttctgacgttgac
tatcgactcttagaggcatctaaagccggagacttggaaactgtgaagcaactttgcagc
cctcagaatgtgaattgcagagatttagagggccggcattctacgcccttacacttcgcc
gcaggctataaccgtgtgtctgtggtggagtacctcctacaccatggtgccgatgtccat
gccaaagacaaaggtggcttggtgccccttcacaatgcttgctcatatggacactatgag
gtggctgagctcttagtaaggcatggggcttctgtcaatgtggcagacttgtggaaattt
acccctctacatgaagcagcagctaaaggaaaatatgaaatctgcaaactccttttaaaa
catggagcagatccgactaaaaagaacagagatggaaatacacctttagatttggtaaaa
gaaggagacacagatattcaggacttactgagaggagatgctgccctgttggatgctgcc
aagaagggctgcctggcaagagtgcagaagctctgtactccagagaatatcaactgcaga
gacacccagggcagaaactcaacccctctgcacctggcagcaggctacaataacctggaa
gtagctgaatatcttctagaacatggagcagatgttaatgcccaggacaaaggtggttta
attcctcttcataatgcagcgtcctacgggcatgtggacatcgcagcattgctgataaaa
tataacacatgtgtgaatgcaacagacaagtgggcgtttactccccttcacgaagcagcc
caaaaaggcaggacacagctttgtgccctcctcctggcacatggcgcagatccaactatg
aagaaccaagaaggtcagacacctttagatctggcaacagctgatgatatcagagctttg
ctgatagatgccatgcccccagaggccttacctacctgttttaaacctcaggccactgta
gtgagtgcctctctcatctcaccagcatccactccctcctgcctgtctgctgccagcagc
atagacaacctcaccggccccttagcggagctggcggtaggaggagcagccaacactgca
gatggtgcagcgggtgcagaaaggaaggaaggagaagttgcgggtcttgacatgaatatc
agtcaatttctgaaaagccttggtcttgaacaccttcgggacatctttgaaacagaacag
attacactagatgtattggctgatatgggtcatgaagagttgaaagaaataggtatcaat
gcatatggacaccgccataaattaatcaaaggagtagaaagactcttaggtggacaacaa
ggaaccaatccttatttgacttttcactgtgttaatcagggaactattttgctggatctt
gctccagaagataaggaatatcagtcagtagaagaagagatgcagagtacgattcgagaa
cacagagatggcggtaatgctggcggcatcttcaacagatacaatgtcatccgaattcaa
aaagttgtcaacaagaagttgagagaacgattctgtcacagacaaaaggaggtgtctgag
gagaatcacaaccaccacaacgagcgcatgttgtttcacggttctcctttcattaatgcc
attattcataaagggtttgatgagcgacatgcgtacataggaggaatgtttggtgccggg
atttattttgcagaaaactcctctaaaagcaaccagtatgtttatggaattggtggagga
acaggctgccccacgcacaaagatcggtcatgttacatatgtcacagacaaatgcttttc
tgtagagtgacccttggcaagtcctttctgcagttcagcaccatgaaaatggctcacgct
cccccaggccatcactccgtcattgggagaccgagtgtgaatgggctggcgtatgctgag
tatgtcatctacagaggagagcaggcgtacccagagtatctcatcacgtaccagatcatg
aagccagaagctccctcacagaccgcaacagccgcagagcagaagacctag

DBGET integrated database retrieval system