KEGG   Camelus dromedarius (Arabian camel): 105102445Help
Entry
105102445         CDS       T04642                                 

Gene name
LTB4R
Definition
(RefSeq) leukotriene B4 receptor
  KO
K04296  leukotriene B4 receptor 1
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    105102445 (LTB4R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cdk04030]
    105102445 (LTB4R)
G protein-coupled receptors [BR:cdk04030]
 Rhodopsin family
  Lipid
   Leukotriene
    105102445 (LTB4R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Motif
Other DBs
NCBI-GeneID: 105102445
NCBI-ProteinID: XP_010994113
Position
Un
AA seq 314 aa AA seqDB search
MATNITSSAAPSSPGVMFISLLAIILLSVALAVGLPGNSFVVWSILVKMRKRSVTALLVL
NLALADLAVLLTGPFFLHFLTQGTWTFGQAGCRLLHYVCGVSMYASVLLITAMSLDRSLA
VALPFVSQKLRTKAVAWRVLVGIWVVSVLLATPVIAYRQVNLGPNNRSLICFPKYPSERH
RAFHLFFEVFTGFLLPFLAIVASYSDIGRRLQARRFRRSRRTGRLVVLIILAFAAFWLPY
HVVNLAQAVRAVTGKVVEDGPVGRRLHLARQVLITLAFLSSSVNPVLYACAGGGLLRSAG
VGFVAKLLGGTGSE
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggccacaaacattacatcttctgcagcaccctcctcgccaggtgtcatgttcatctct
ctactggctatcatcttactgtcggtggccctggctgtggggcttcctggcaacagcttt
gtggtgtggagcatcctggtaaagatgcgaaaacgctctgtcactgccctgctggtgctg
aacctggctctggccgatttggccgtattgcttactggcccctttttcctccatttcctg
acccaaggcacctggacttttggacaggctggctgccgcctgctccactatgtctgcgga
gtcagcatgtatgccagcgtcctgcttataacggccatgagtctggaccgctcactggcg
gtggcccttccctttgtgtcccagaagttgcgcaccaaggcggttgcctggagggtgctg
gtaggcatctgggtggtatctgttctgctggccacgcccgtcatcgcgtaccgccaggtg
aacctgggacccaacaataggagccttatatgctttccgaagtaccccagcgaaagacac
agggccttccatctgttcttcgaggtcttcacgggcttcctgttgcccttcctggccata
gtggccagctactccgacatcgggcggcggctgcaggcccggcgcttccgccgcagccgc
cgcaccggccgcctggtggtgctcatcatcctggccttcgccgccttctggctgccctac
cacgtggtgaacctggcccaggcggtccgcgcggtgacgggcaaggtcgtggaggacggg
cccgtggggcggcggctgcacctggcccgccaagtgctcatcacgctggctttcctgagc
agcagcgtgaaccccgtgctgtacgcgtgcgccggcggcggcctgctgcgctcggccggc
gtgggcttcgtcgccaagctgttggggggcaccggctccgag

DBGET integrated database retrieval system