KEGG   Camelus dromedarius (Arabian camel): 105102506Help
Entry
105102506         CDS       T04642                                 

Gene name
CAMKK2
Definition
(RefSeq) calcium/calmodulin dependent protein kinase kinase 2
  KO
K07359  calcium/calmodulin-dependent protein kinase kinase 2 [EC:2.7.11.17]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04140  Autophagy - animal
cdk04152  AMPK signaling pathway
cdk04211  Longevity regulating pathway
cdk04920  Adipocytokine signaling pathway
cdk04921  Oxytocin signaling pathway
cdk05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    105102506 (CAMKK2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105102506 (CAMKK2)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    105102506 (CAMKK2)
   04921 Oxytocin signaling pathway
    105102506 (CAMKK2)
  09149 Aging
   04211 Longevity regulating pathway
    105102506 (CAMKK2)
 09160 Human Diseases
  09165 Substance dependence
   05034 Alcoholism
    105102506 (CAMKK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cdk01001]
    105102506 (CAMKK2)
Enzymes [BR:cdk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     105102506 (CAMKK2)
Protein kinases [BR:cdk01001]
 Serine/threonine kinases: Other
  CAMKK family
   105102506 (CAMKK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal RIO1
Motif
Other DBs
NCBI-GeneID: 105102506
NCBI-ProteinID: XP_010994183
Position
Un
AA seq 530 aa AA seqDB search
MESFIVVTECEPTCAVDPGLARDPPLEADGREVPLDVSGSQPRPHLSSRKLSLQERSQLD
ANGRCVYPGLPHSPVGSPQSSPRLPRRPTVESHHVSITGMQDCVQLNQYTLKDEIGKGSY
GVVKLAYNENDNTYYAMKVLSKKKLLRQAGFPRRPPPRGTRPAPGGCIQPRGPIEQVYQE
IAILKKLDHPNVVKLVEVLDDPNEDHLYMVFELVNQGPVMEVPTLKPLSEDQARFYFQDL
IKGIEYLHYQKIIHRDIKPSNLLVGEDGHIKIADFGVSNEFKGSDALLSNTVGTPAFMAP
ESLSETRKIFSGKALDVWAMGVTLYCFVFGQCPFMDERIMCLHSKIKSQALEFPDQPDIA
EDLKDLITRMLDKNPESRIVVPEIKLHPWVTRHGAEPLPSEDENCTLVEVTEEEVENSVK
HIPSLATVILVKTMIRKRSFGNPFEGSRREERSLSAPGNLLTKKPTRECEPLSEPKEARQ
PGQPPGPRPGPRGGGGSALVKGGPRVESWGALGPSSRSRTHLLRPDEVME
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atggagtccttcatcgtggtcacggagtgtgagccgacctgcgctgtggaccccggcctg
gcccgggacccgcctctggaggccgacggcagagaggtccccctcgacgtttccgggtcc
cagccccggcctcacctctccagtcgcaagctctctctacaggagcggtcccagctggat
gcgaatgggcgctgcgtctacccgggcctgccccactcgcccgtgggctccccgcagtcc
tcgccacggctgccccggcggcccacggtggagtcgcaccacgtctccatcaccgggatg
caggactgtgtacagctaaatcagtacactctgaaggatgaaattggaaagggctcctat
ggcgtggtcaagttggcctacaatgaaaatgacaatacgtactacgcaatgaaggtgttg
tccaaaaagaagttgctccgacaggcgggctttccacgtcgccccccaccccgaggcacc
cggccggcccccgggggctgcatccagcccaggggccccattgagcaggtttaccaggaa
attgccatcctcaagaaactggaccaccccaatgtggtgaagctggtggaggtcctggat
gaccccaatgaggaccatctgtacatggtgtttgaactggtcaaccaagggcctgtgatg
gaagtgcccaccctcaaaccactctctgaagaccaggctcgtttctacttccaggacctg
atcaaaggcattgagtacttgcactaccagaagatcatccaccgggacatcaaaccttca
aacctcctggtcggagaagatgggcacatcaagattgcagactttggtgtgagcaacgag
ttcaagggcagcgacgccctcctctctaacactgtgggcacgcctgccttcatggcgccg
gagtcgctctcggagacccggaagatcttctctgggaaggcattggatgtttgggccatg
ggtgtgacgctgtactgctttgtgtttggccagtgcccgttcatggatgagcggatcatg
tgtttacacagtaagatcaagagtcaggccctggaatttccagatcagcccgacatagct
gaggacttgaaggatctgatcacccgcatgttggacaagaacccggagtcgaggatcgtg
gtgcctgagataaagctgcacccctgggtcacgaggcacggggcggagccgttgccatcg
gaggacgagaactgcacgctggtcgaggtgaccgaagaggaggtcgagaattcggtcaaa
cacattcccagcctggcgaccgtgatcctggtgaagaccatgatacgaaaacgctccttc
gggaacccgtttgagggcagccggcgggaggagcgctcattgtcagcgcctggaaacctg
ctcaccaaaaaacccaccagggagtgtgagcccctgtctgagcccaaggaagcaaggcag
ccaggacagcctccggggccccgacccggcccccgtgggggaggaggaagtgctcttgtg
aaaggcggccctcgcgtggagagttggggggccttgggccccagctcccgctcccgcaca
catcttctgcggccggacgaggtgatggagtag

DBGET integrated database retrieval system