KEGG   Camelus dromedarius (Arabian camel): 105102766Help
Entry
105102766         CDS       T04642                                 

Gene name
TBX6
Definition
(RefSeq) T-box 6
  KO
K10180  T-box protein 6
Organism
cdk  Camelus dromedarius (Arabian camel)
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cdk03000]
    105102766 (TBX6)
   03019 Messenger RNA biogenesis [BR:cdk03019]
    105102766 (TBX6)
Transcription factors [BR:cdk03000]
 Eukaryotic type
  Other transcription factors
   T-box
    105102766 (TBX6)
Messenger RNA biogenesis [BR:cdk03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     105102766 (TBX6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: T-box
Motif
Other DBs
NCBI-GeneID: 105102766
NCBI-ProteinID: XP_010994497
Position
Un
AA seq 437 aa AA seqDB search
MYHPRELYPSLGSGYRLGPPQPGADSSFSPALAEGYHRYPDLDTPKLDCFLSGIETAPRT
LAAPPPLPPLPPALGAEPPPPAPEALHSLPGVNLSLENRELWKEFNSVGTEMIITKAGRR
MFPACRVSVTGLDPEARYLFLLDVVPVDGARYRWQGRRWEPSGKAEPRLPDRVYIHPDSP
ATGAHWMRQPVSFHRVKLTNSTLDPHGHLILHSMHKYQPRIHLVRAAQLCSQHWGGVASF
RFPETTFISVTAYQNPRITQLKIAANPFAKGFRENGRNCKRERDARVKRKLRGPEPVATA
AYGSGDAPGGPCDSTLGGDVRESDPEQAPAPREAAPAQAPPCGGPSAEAYLLHPAAFHGA
PSHLPTRNPSFPEAPDSGRPAPYSAAFLELQPGPAGSGYPAAAPPASFASHFLQGGPFPL
PYPGAGAYLDVGSKPMY
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgtaccacccacgagagttgtacccctccctggggtctggctaccgtcttgggcccccg
cagcctggggcagattctagcttctcgcctgccctagcagagggctaccaccgctacccg
gatctggacactcccaaactggactgcttcctctctgggattgagactgctccccgcact
ctggctgctcccccacccctaccccctctgcccccagccctgggcgctgagccgccccca
ccagccccagaggcccttcattcactccctggagtcaacctgagcctggagaaccgggag
ctatggaaagagttcaactccgtgggaacggagatgatcatcaccaaagctgggaggcgc
atgttccctgcttgccgagtatcggtcaccggcctggaccccgaggcccgctacctgttt
cttctggatgtggttcctgtggatggggctcgctaccgctggcagggccggcgctgggag
cccagtggcaaggcagagccccgcctgcctgaccgcgtttacattcaccctgactctcct
gccaccggtgcccactggatgcggcagcctgtgtccttccatcgcgtcaagctcaccaac
agcacactggacccccatggccacctgatcttgcactccatgcataagtatcagccccgc
atacacctggtgcgggctgcccagctttgcagccaacactggggaggcgttgcctccttc
cgcttccctgagaccacgttcatctccgtgacagcctatcagaacccacggatcacacaa
ctgaagatcgcagccaatccctttgccaagggcttccgggagaatggcagaaactgtaag
agggagcgagacgcccgtgtgaagaggaaactgcggggcccagagccagtagccacagcg
gcctatgggagtggagatgcaccaggtggtccctgcgattccacactgggtggggacgtt
cgtgagtcagatccagagcaggccccagcaccccgggaagctgcccctgcccaagctcct
ccatgtggtggccccagtgccgaggcctaccttctgcaccctgcagctttccatggggcc
cccagtcaccttccaactaggaaccccagcttccctgaggctcctgattcggggcgccca
gccccctactcggctgccttcctggagctgcagcctgggccagcaggctcaggataccca
gcagctgcgcccccagcatcctttgcctcgcacttcctccaagggggccccttccccctg
ccctaccctggggctggggcttacctggatgtgggctccaaaccaatgtactga

DBGET integrated database retrieval system