KEGG   Camelus dromedarius (Arabian camel): 105102964Help
Entry
105102964         CDS       T04642                                 

Gene name
SOX7
Definition
(RefSeq) LOW QUALITY PROTEIN: transcription factor SOX-7
  KO
K09270  transcription factor SOX7/8/10/18 (SOX group E/F)
Organism
cdk  Camelus dromedarius (Arabian camel)
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cdk03000]
    105102964 (SOX7)
Transcription factors [BR:cdk03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG SOX
    105102964 (SOX7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HMG_box Sox17_18_mid HMG_box_2
Motif
Other DBs
NCBI-GeneID: 105102964
NCBI-ProteinID: XP_031297983
Position
31
AA seq 389 aa AA seqDB search
MASLLGAYPWPEGLECPALEAELXDGLSPPAAPRPPGDKGSESRIRRPMNAFMVWAKDER
KRLAVQNPDLHNAELSKMLGKSWKALTLSQKRPYVDEAERLRLQHMQDYPNYKYRPRRKK
QAKRLCKRVDPGFLLSSLSRDQNALPEKRGGGRAALGEKEDRGEYSPGSALPSLRGCFHE
GPAGGGGGGGGTGTPGSVDAYPYGLPTPPEMSPLDALEPEQTFFSSPCQEEHAHSRRIPX
XXAPPYSPEYAPSPLHCGHPLSSLTLGQSSGVSMMPGCPPSPAYYSPATYPPLHSNLHAH
LGQLSPPPEHPGFDALDQLSQAELLGDMDRNEFDQYLNTPGHPDSAAGAVALSGQAAVSQ
VTPTGPTETSLISVLADATATYYNSYSVS
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggcctcgctgctgggagcttacccgtggcccgaggggctcgagtgcccggccctggaa
gccgagctgnntgacgggctgtcgccgccggccgccccccgcccgccgggggacaagggc
tcggagagccggatccggcggcccatgaacgccttcatggtgtgggccaaggacgagagg
aaacgtctggcggtgcagaacccggacctgcacaacgccgagctcagcaagatgctggga
aagtcgtggaaggcgctgacgctgtcccagaagaggccctacgtggacgaggcggagcgg
ctgcgcctgcagcacatgcaggattaccccaactacaagtaccgcccgcgcaggaagaag
caggccaagcgcctgtgcaagcgcgtggaccccggcttcctgctgagctcgctctcccgc
gaccagaacgctctgcccgagaagcggggcggcggccgggcggcgctgggggagaaggag
gaccggggtgagtactccccgggctccgcgctgcccagcctgcggggctgcttccatgag
ggcccggccggcggcggcggcggcggcggcggcaccggcaccccgggcagcgtggacgcg
tacccttacgggctgcccaccccgccggagatgtcgcccctggacgcgctggagccggag
cagaccttcttctcctccccctgccaggaagagcatgcgcactcccgccgcatcccnnnn
nnnnccgcgcccccctactcgccggagtatgcccccagccccctccactgcggccacccc
ctgagctccctgaccctcggccagtcctcaggcgtctctatgatgcctggctgtcccccg
tcccctgcctattactcccctgcaacctacccgcctctccactccaacctccatgcccac
ctgggccagctctccccgcctcccgagcaccccggctttgacgccctggatcagctgagc
caggcggaactcctgggggacatggatcgcaatgagttcgaccagtacttgaacactccc
ggccacccagactctgccgccggggctgtggccctcagtgggcaggccgcggtctctcag
gtgacaccaacgggccccacggagaccagcctcatctccgtgctggctgatgccacggcc
acgtactacaacagctacagcgtgtcatag

DBGET integrated database retrieval system