KEGG   Camelus dromedarius (Arabian camel): 105103146Help
Entry
105103146         CDS       T04642                                 

Gene name
ACOD1, IRG1
Definition
(RefSeq) aconitate decarboxylase 1
  KO
K17724  aconitate decarboxylase [EC:4.1.1.6]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    105103146 (ACOD1)
Enzymes [BR:cdk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.6  cis-aconitate decarboxylase
     105103146 (ACOD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MmgE_PrpD
Motif
Other DBs
NCBI-GeneID: 105103146
NCBI-ProteinID: XP_010994965
Position
Un
AA seq 471 aa AA seqDB search
MMLKSVTASFAKVIHGLKVGHLTDHVIQRSKRMILDTLGVGLLGTNTEVFHKAHEYSKVY
TSSVSSTVWGRPGFGLPPAYAAFVNGVAIHSMDFDDTWYPATHPSGPVLPVLMALSEALP
PSPKCSGLDLLLAFNVGIEVQGRLMHFSKEANDIPKRFHPPSVVGTLGSAAAASKFLGLS
VTECQEALAIAVSHAGAPMANAATQTKPLHIGNAARHGIEAVFLAMLGLQGNKQVLDMET
GFGAFYANYSPKVLPDLDSHTWLLDQQDVAFKVFPAHLATHWVANAAASVRRHLVTDRAL
LPIDCIERIVLRIPDVQYVNRPFPDSEHEARHSFQYVACATLLDGAIAVPSFHKCQINRP
QVRELLGKVELEHPRDNLPNFNTLYCEVSVVLKDGAIFTERCDTFYGHWRKPLSQKDLRE
KFRANASRVLSCHTVERLIELVENLEVVGDCSVLTALLKELSPPEVASKSI
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgatgctcaagtctgtcacagcaagctttgccaaagtgatccatggcttgaaagtggga
cacctgaccgatcacgtcattcagaggagcaagaggatgattctggatactctgggcgtt
gggctcctgggaaccaacacagaagtgtttcacaaagcccatgaatacagtaaagtctac
acttccagtgtatccagcactgtttggggtcggccaggcttcgggctcccaccagcatat
gctgctttcgttaacggtgtggctattcactcaatggattttgatgacacgtggtaccct
gccactcacccttctggacctgtccttcctgtcctcatggctttatcagaagccctgcct
ccaagtccgaagtgttctggccttgacctgctgctggctttcaatgttggaattgaagtg
caaggccgattaatgcatttctccaaggaagccaatgacataccaaagagattccatccc
ccctcagtggtgggaactctggggagtgctgctgctgcatctaagtttttggggctcagc
gtgacggagtgccaagaggccctggctattgctgtttctcatgctggggcacccatggca
aatgccgccactcagaccaagccccttcatattggcaatgctgctaggcatgggatagaa
gctgttttcctggcaatgctgggtctccagggaaacaagcaggtcttggacatggagaca
gggtttggggccttctatgccaactattccccaaaagtccttccagacctagattcacat
acttggttgctggaccagcaggatgtggccttcaaggttttccctgcgcatctggccacc
cactgggtggcaaacgcagctgcatctgtgagaagacaccttgtgacagacagagccctg
cttcccattgactgcattgagagaattgtgcttagaattccagatgtccagtatgtgaat
aggcccttcccagactcagagcacgaagcccgccactccttccagtatgtggcctgtgcc
acgctgcttgatggtgccatcgctgtcccatcgttccacaaatgccagatcaacaggcca
caggtgagagagctgctgggtaaggtggagctggagcaccctcgagacaacctcccaaac
ttcaacacactgtactgcgaggtaagtgtcgtcctcaaggatggagccatcttcacagag
cgctgtgataccttctacggtcactggaggaagcctctaagccagaaggacctacgggaa
aagttcagagccaatgcctccagggtgctgtcctgccacacagtagaaaggcttatagag
ctagtagaaaacctagaagtcgtaggagactgttctgtgctgactgctcttctgaaagaa
ctctctccaccagaagtggcttcaaaatctatctag

DBGET integrated database retrieval system