KEGG   Camelus dromedarius (Arabian camel): 105103264Help
Entry
105103264         CDS       T04642                                 

Gene name
CACNG7
Definition
(RefSeq) calcium voltage-gated channel auxiliary subunit gamma 7
  KO
K04872  voltage-dependent calcium channel gamma-7
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04010  MAPK signaling pathway
cdk04260  Cardiac muscle contraction
cdk04261  Adrenergic signaling in cardiomyocytes
cdk04921  Oxytocin signaling pathway
cdk05410  Hypertrophic cardiomyopathy (HCM)
cdk05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
cdk05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105103264 (CACNG7)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    105103264 (CACNG7)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    105103264 (CACNG7)
   04261 Adrenergic signaling in cardiomyocytes
    105103264 (CACNG7)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    105103264 (CACNG7)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    105103264 (CACNG7)
   05414 Dilated cardiomyopathy (DCM)
    105103264 (CACNG7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:cdk04040]
    105103264 (CACNG7)
Ion channels [BR:cdk04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   105103264 (CACNG7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Claudin_2 PMP22_Claudin DUF716 Amastin Claudin_3 L_HMGIC_fpl
Motif
Other DBs
NCBI-GeneID: 105103264
NCBI-ProteinID: XP_010995136
Position
Un
AA seq 275 aa AA seqDB search
MSHCSSRALTLLSSVFGACGLLLVGIAVSTDYWLYMEEGTVLPQNQTTEVKMALHAGLWR
VCFFAGREKGRCVASEYFLEPEINLVTENTENILKTVRTATPFPMVSLFLVFTAFVISNI
GHIRPQRTILAFVSGIFFILSGLSLVVGLVLYISSINDEVMNRPSSSEQYFHYRYGWSFA
FAASSFLLKEGAGVMSVYLFTKRYAEEEMYRPHPAFYRPRLSDCSDYSGQFLQPEAWRRG
RSPSDISSDVSIQMTQNYPPAIKYPDHLHISTSPC
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgagtcactgcagcagccgcgccctgaccctgctgagcagcgtgtttggcgcgtgtggc
ctgctgctcgtgggcatcgcggtcagcacggactactggctgtacatggaggagggaacg
gtgctgccgcaaaaccaaaccacggaggtcaagatggcgctgcatgccggcctatggcga
gtctgcttcttcgcaggcagggaaaagggtcgctgcgtggcctcagaatatttccttgaa
ccggagatcaacttggtgacggaaaacacggagaatattctgaagacagtgcgcacagcc
acccccttccccatggtcagtctcttcctcgtgttcaccgcgttcgtcatcagcaatatc
ggccacatccgcccacagaggaccattctggccttcgtttccggaatcttcttcatcctg
tcgggcctctccttggtggtgggcctggttctttacatttccagcatcaacgacgaggtc
atgaacaggcccagcagctccgagcagtatttccactatcgctacgggtggtcttttgcc
ttcgccgcttcctccttcctactcaaagagggagctggcgtgatgtccgtgtacttgttc
accaagcgctacgcggaggaggagatgtaccgtccgcacccggccttctaccgcccgcgt
ctcagcgactgctccgactactcgggccagtttctgcagcccgaggcgtggcgccgcggc
cgcagtccctccgatatctctagcgatgtgtccatccagatgacgcagaactatcctccg
gccatcaagtaccctgaccacctgcacatctccacctcgccctgctga

DBGET integrated database retrieval system