KEGG   Camelus dromedarius (Arabian camel): 105103293Help
Entry
105103293         CDS       T04642                                 

Gene name
WDR45
Definition
(RefSeq) WD repeat domain 45
  KO
K22991  WD repeat-containing protein 45
Organism
cdk  Camelus dromedarius (Arabian camel)
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cdk04131]
    105103293 (WDR45)
Membrane trafficking [BR:cdk04131]
 Autophagy
  Other autophagy associated proteins
   Others
    105103293 (WDR45)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 CNH CPSF_A
Motif
Other DBs
NCBI-GeneID: 105103293
NCBI-ProteinID: XP_010995157
Position
Un
AA seq 361 aa AA seqDB search
MTQQPLRGVTSLRFNQDQSCFCCAMETGVRIYNVEPLMEKGHLDHEQVGSMGLVEMLHRS
NLLALVGGGSSPKFSEISAVLIWDDAREGKDSKDKLVLEFTFTKPVLAVRMRHDKIVIVL
KNRIYVYSFPDNPRKLFEFDTRDNPKGLCDLCPSLEKQLLVFPGHKCGSLQLVDLASTKP
GTSSAPFTINAHQSDVACVSLNQPGTVVASASQKGTLIRLFDTQSKEKLVELRRGTDPAT
LYCINFSHDSSFLCASSDKGTVHIFALKDTRLNRRSALARVGKVGPMIGQYVDSQWSLAS
FTVPAESACICAFGRNTSKNVNSVIAICVDGTFHKYVFTPDGNCNREAFDVYLDICDDDD
F
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgactcagcagccacttcgaggagtgaccagtctgcgtttcaaccaagaccaaagctgc
ttctgctgtgccatggagacaggtgtgcgcatctacaacgtggaaccattgatggagaag
gggcatctggaccatgagcaggtgggcagcatgggcctggtggaaatgctgcaccgctcc
aacctgctggccctggtgggcggtggtagcagccccaagttctcagagatctcagcagtg
ctgatctgggacgatgcccgggagggcaaggactccaaggacaagctggtgctggagttc
accttcaccaagccagtgctggctgtgcgcatgcgccatgacaaaatcgtgatcgtgctg
aagaaccgcatctatgtgtactccttccccgacaatccccgaaagctgtttgagtttgac
acccgggacaaccccaaggggctctgtgatctctgccccagcctggagaaacaactgcta
gtgttcccaggacacaagtgcgggagcctgcaacttgtggacctggcgagcacaaagccc
ggcacttcatctgctccgtttaccatcaatgcacatcagagtgacgtggcctgcgtgtcc
ctgaaccagccaggcacggtagtggcctcagcctctcagaagggcacccttattcgcctt
tttgacacacagtccaaagaaaaactggtggagctgcgtcgaggcactgaccctgccacg
ctctactgcatcaacttcagccacgattcctccttcctctgtgcgtccagtgataagggc
acagtccatatctttgctctgaaagatacccgcctcaaccgccgctccgcgctggctcgt
gtgggcaaggtgggacctatgattgggcagtacgtggattctcagtggagcctggccagc
ttcaccgtgcctgctgagtcagcctgcatctgtgcttttggtcgcaatacttccaagaat
gtcaactctgtcattgccatctgtgtagatgggaccttccacaaatatgtcttcactcct
gatggaaactgcaacagagaggctttcgatgtgtaccttgacatctgtgatgacgatgac
ttttaa

DBGET integrated database retrieval system