KEGG   Camelus dromedarius (Arabian camel): 105105879Help
Entry
105105879         CDS       T04642                                 

Gene name
DOCK8
Definition
(RefSeq) dedicator of cytokinesis protein 8 isoform X2
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
cdk  Camelus dromedarius (Arabian camel)
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cdk04131]
    105105879 (DOCK8)
Membrane trafficking [BR:cdk04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    105105879 (DOCK8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N GPR15L
Motif
Other DBs
NCBI-GeneID: 105105879
NCBI-ProteinID: XP_010998005
Position
4
AA seq 2028 aa AA seqDB search
MTHLNSLDVELAQELGDFTEDDLDVVFTSKECRTLQPSLPEEGVELDPHVRDCVQTYIRE
WLIVNRKNQGSSEICGFKKTGSRKDFHKTLQKQTFESETLECSEPRAQAGPRHLNVLCDV
SGKGPITACDFDLRSLQPDPRLENLLQQVSAEDFEKQNEEARRTNRQAELFALYPSVDEE
DAVEIRPVPECPKEHLGNRILVKLLSLKFEIEIEPLFASIALYDVKERKKISENFYCDLN
SDQFKGFLRAHTPSVATSSQARSAVFSVTYPSPDIYLVVKIEKVLQQGEIGECAEPYMVI
KESDGGKSKEKIEKLKLQAESFCQRLGKYRMPFAWAPISLASFFNVSTLDREVTDVESMV
GKGSAGERRTLSQSRRLSERAFSLEENGVVKPMTVNSFFKQEGDRLSDEDLFKFLADYKR
SSSLQRRVKSIPGLLKLEVSMAPETVNCCLTPEMLPVRPFPENRGRPHKEILEFPIREVY
VPHTVYRNLLYVYPQRLNFANKLASARNITIKIQFMCGEDASNAMPVIFGKSNGPEFLQE
VYTAVTYHNKSPDFYEEVKIKLPAKLTVSHHLLFTFYHISCQQKQGNSVESLLGYSWLPV
LLNERLQTGSYCLPVALEKLPPNYSMHSAEKVPLQNPPIKWAEGHKGVFNIEVQAVSSVH
TQDNHLEKFFILCHSLESQVTFPIRVLDQKISESTLEHELKLSIICLNSSRLEPLVLFLH
LMLDKLFQLFVQPMVIAGQTANFSQFAFESVVATANSLHNSKSLGKDQHGRNCLLASYVH
YVFRLPEPQRDVPKSGGPTALPDPRYHTYGRTTAAAVSSKLLQARAMSSSNPDLAGMHST
ADEEVKNIMSSKIADRSCNRMSYYCSGNNDAPSSTTTPRPVSKKHFHEELALQMVVSTGM
VKETAFKYSWFFFELLVKSMAQYVHNMDKRDNFRRTRFSDRFKDDITTIVNVVTSEIAAL
LVKPQKETEQAEKMNISLAFFLYDLLSLMDRGFVFNLIKHYCNQLSAKLNNLPTLISMRL
EFLRILCSHEHYLNLNLFFMNADTAPASPCPSISSQNSSSCSSFQDQKIASMFDLTPEYR
QQHFLTGLLFTELAAALDAEGEGISKVQRKAVSAIHSLLSSHDLDPRCVKPEVKVRVAAL
YLPLVGIILDALPQLYDFTAADARSGKGRANGSDEEQEGTSAINQNVALAIAGNHFNLKT
SGTMLSSLPYKQYNMLNANVTRNLMICFLWIMKNADQSLLRKWIADLPSMQLNRILDLLF
ICVSCFEYKGKQSSDKVSTQVLQKSRDVKARLEEALLRGEGARGEMMRRCRAPGNDRFPG
LNENLRWRKEQTHWRQANEKLDKTKAELDQEALISGNLATEANLIILDMQENIIQASSAL
DCKDSLMGGVLRVLVNSLSCDQSTTYLTHCFATLRALIAKFGDLLFEEEVEQCADLCQRV
LHHCSSSMDVTRSQACATLYLLMRFSFGATSNFARVKMQVTMSLASLVGKAPDFNEEYLR
RSLRTILAYAEEDTAMQTTPFPMQVEELLCNLNSILYDTVKMREFQEDPEMLMDLMYRIA
KSYQTSPDLRLTWLQNMAEKHTKRKCYTEAAMCLVHAAALVAEYLSMLEDHSYLPVGSVS
FQSISSNVLEESAVSDDTLSPDEDGVCSGRYFTESGLVGLLEQAAELFSTGGLYETVNEV
YKLVVPILEAHRDFRKLTSTHEKLQKAFDSIISKGHKRMFGTYFRVGFYGSKFGDLDEQE
FVYKEPAITKLPEISHRLEGFYGQCFGAEFVEVIKDSAPVDKTKLDPNKAYIQITFVEPY
FDEYEMKDRLTYFEKNFNLRRFMYTTPFTLEGRPRGELHEQYRRNTVLTTMHAFPYIKTR
ISVIQKEEFVLTPIEVAIEDMKKKTLQLAVAINQEPPDAKMLQMVLQGSVGATVNQGPLE
VAQVFLAEIPADPKLYRHHNKLRLCFKEFIMRCGEAVEKNKRLITTDQREYQQELKKNYN
KLKESLRPMIERKIPELYKPLFRVESQKRDSFHRSSFRKCETQLSQGS
NT seq 6087 nt NT seq  +upstreamnt  +downstreamnt
atgacacacctgaacagcctggatgtggagcttgcccaggagttgggggacttcaccgaa
gacgacttggacgtggtcttcacatcaaaggaatgtcgaactttgcagccttctctgccg
gaggaaggggttgaactagaccctcacgtcagggactgcgttcagacctatattcgggag
tggctaattgtgaaccggaaaaaccaaggaagttcggagatttgcggctttaagaagact
ggatcccgaaaagactttcacaagacgcttcagaaacagacgtttgagtcagaaaccttg
gagtgcagtgaaccccgcgctcaggccgggccccgccacttaaacgtgctgtgcgatgta
tctgggaaaggccccatcactgcctgtgacttcgacctgcgcagcctgcagcctgacccg
cggctggaaaacctcctgcaacaagtgagtgctgaggacttcgagaagcagaacgaggag
gcccggaggaccaaccggcaggctgagctcttcgctctttacccatcagtggacgaggag
gatgcagtggaaatacgtccggtaccagaatgtcctaaggaacatctgggcaacagaata
ttggtcaagttgctatccctgaagtttgagatcgaaattgagcctctgtttgccagcatt
gccctctatgatgttaaagaaaggaaaaagatctcagaaaatttttactgtgacctgaac
tctgaccagttcaaaggatttctgcgtgctcacacaccctctgttgctacatccagtcag
gcaagatctgcggtattctcagtcacctatccatccccggacatctacctagtagtaaag
attgaaaaagtccttcagcagggagagattggagagtgtgcagaaccctacatggttatc
aaagaaagtgatggtggaaagagtaaagaaaagattgaaaaactaaaacttcaagctgaa
tccttctgccaacgtttggggaaataccggatgccctttgcctgggctcccataagctta
gcaagtttcttcaatgtctctaccctggacagggaggtaaccgatgtggagtccatggtt
gggaaaggctctgcgggtgagcggagaactttgtcccaatctcgaagactttcggaaaga
gccttctccttggaggaaaatggggtcgtgaagcccatgactgtcaacagctttttcaag
caggagggagatcgccttagtgacgaagacttattcaagtttttagctgactacaaaaga
tcttcatccctgcagagaagagtcaagtcgattccaggcttgctcaaactagaggtttct
atggctccggagacagtcaattgctgtctgacccctgaaatgctgccagtgagacccttt
cctgaaaaccggggacgtccacacaaagagattttggaatttccaatccgggaagtgtat
gtccctcatactgtgtacagaaaccttctctatgtctacccacagaggctgaactttgct
aacaagctagcatctgcccggaacatcacaataaaaatccagtttatgtgtggagaggat
gccagcaatgctatgccggtcatctttggaaaatccaacgggcctgaatttttgcaggaa
gtgtacacagccgttacataccataacaagtctcctgacttctacgaagaagtgaaaatt
aagctccctgctaagctcacagtcagtcaccacctcctgttcaccttctatcatatcagc
tgtcagcagaagcaaggaaactctgtcgaaagtctcctgggatattcatggctgccagtt
ctcttaaatgaacgtcttcaaactggatcctactgtctcccagttgccttggaaaagctg
ccacccaactactccatgcactctgcagagaaagtccctttacagaatccacccattaag
tgggctgaaggacacaagggagtattcaatattgaagtgcaagctgtttcttctgttcac
acccaggacaaccacctggagaagttcttcatcctctgccactccctggagagccaggtg
accttccccatccgcgtgctggaccagaagatcagtgagtcaacactagagcacgagctg
aagctcagcatcatctgcctgaactcctcccgcctggagcccctcgtgctcttcctgcac
ctgatgctggacaagctcttccagctgtttgtgcagcccatggtcattgctggccagaca
gctaacttctcccagtttgcctttgagtccgtggtggccaccgccaacagtctgcacaac
agcaagagcctgggcaaggaccagcatgggaggaactgcctgctggcctcctatgtgcac
tacgtcttccgccttccggagccgcagagggacgtgcccaagtcaggtggccccactgcc
ctcccagaccctcgctaccacacatacggacgcacaactgctgccgccgtgagttcgaaa
ctgctacaggcccgggcgatgagcagcagtaacccagacctcgcagggatgcactccaca
gcagatgaggaagttaagaatatcatgtcttcaaagattgctgatcgcagctgcaaccga
atgtcttactattgctctggcaataacgatgctccaagttcaacaacaaccccaaggcca
gtcagcaagaagcatttccatgaggagcttgccctgcagatggtggtcagcactggaatg
gtgaaagaaacagccttcaagtactcctggttcttctttgagcttctggtaaaaagcatg
gcccagtatgtacataatatggacaaacgggacaattttcggaggactcgcttttctgac
cgtttcaaagatgacataactactattgttaatgtggtcacctcggagattgcagccctt
ttagtaaaacctcagaaggaaactgaacaggcggaaaagatgaacatcagcctggctttc
ttcttgtatgaccttctctcactcatggatcgtggctttgtatttaacctcatcaaacat
tattgcaaccagctgtcagccaagctcaacaacctcccaacgctcatttccatgaggctg
gagttcctgagaatcctctgcagccacgaacattacctcaatctgaacctcttctttatg
aatgccgatactgctccagcatctccctgcccctccatatcctcccagaactccagctcc
tgctccagtttccaggaccagaagattgccagcatgtttgacctgacaccggagtaccgc
cagcaacacttcctcaccgggcttctctttactgaactggctgccgccttggacgccgaa
ggggaagggatcagcaaagtgcaaaggaaagctgtcagtgccatccacagcctgctcagt
tctcacgacctggacccgcgttgtgtcaaaccagaggtaaaggtcagagtcgctgccctc
tacctgcctttggttggtatcattttggatgctttgccacagctctatgactttacagcc
gcagatgcccgtagtggaaaaggtcgtgccaatggctcagatgaagaacaagaagggacc
agtgcaattaaccagaatgtggcactggccatagctgggaaccactttaatctgaagaca
agtggaacaatgctgtcttccctgccctacaagcagtataacatgctgaatgccaacgtg
acccgaaacctcatgatttgcttcctctggatcatgaaaaatgctgatcagagcctcctt
aggaagtggattgccgacctaccatcgatgcaactcaacaggattttagatctccttttc
atctgtgtctcgtgttttgaatacaagggaaagcagagttctgacaaagtcagtacccaa
gttctgcagaagtcaagggatgtgaaggccaggctggaagaggctttgctccgcggggaa
ggggccagaggggagatgatgcggcgctgccgggctccagggaatgaccgatttccaggc
ctaaatgaaaacttgagatggaggaaagagcagacacattggcggcaagctaatgagaag
ctagataaaacaaaggcagagttagatcaagaagccttaatcagtggcaatctggctaca
gaagcaaatttaatcatcctggatatgcaggaaaacattatccaggcaagctcagctctg
gactgtaaagacagcctgatgggaggcgtgctcagggtactggtgaattctctgagctgt
gatcagagcaccacctatctgactcactgctttgcgacactccgagctcttattgccaag
tttggcgacttgctgtttgaggaggaagtggagcagtgcgcggacctgtgtcagcgagtg
ctgcatcactgcagcagcagcatggacgtcacccgcagccaggcctgcgccacactgtac
ctcctcatgaggttcagctttggagccaccagtaactttgcaagagtaaagatgcaagta
accatgtctctggcatctttggtgggaaaagcaccagactttaatgaggaatacctgaga
agatctttaaggacaattttggcctatgcagaagaggacacagccatgcagaccactccc
ttccccatgcaggtggaggaacttctctgcaatctgaatagcatcttatatgacacggtg
aaaatgagggaatttcaggaagatcctgagatgcttatggacctcatgtacagaattgcc
aagagttaccagacatcccctgatctgcgactgacctggctccagaacatggcggagaaa
cacaccaagaggaaatgctacacagaggccgccatgtgcctggtgcacgcggccgccctg
gtggctgagtatctgagcatgctggaggaccacagctacctgcctgtgggcagtgtcagc
tttcagagtatttcttccaatgtgctggaggagtctgcggtctccgacgacaccctgtca
cctgatgaggacggtgtgtgctctggccggtacttcactgagagtggcctggtgggcctc
ctggagcaggcggctgagctcttcagcacgggaggactgtacgagacagttaacgaggtc
tacaagctggtcgtccccatcctggaagctcatcgagacttccggaagctgacctccact
cacgagaagctgcagaaggcctttgacagcatcatcagcaagggtcataagagaatgttt
gggacctacttccgagttggtttctatggatccaaatttggggatttggatgagcaggaa
tttgtttacaaagagcctgcgattaccaagcttcctgagatctctcatagactagaggga
ttttatggtcaatgttttggtgcagaatttgtggaagtgataaaagactctgctcctgtg
gataaaaccaagttggaccctaacaaggcctacatacagatcacttttgtggagccctac
tttgatgagtacgagatgaaagacaggctaacctactttgagaagaattttaatctgcgg
aggttcatgtacaccacccccttcaccctggaggggaggcctcgaggagagctgcacgag
cagtaccggaggaacaccgtcctgaccaccatgcacgccttcccctacatcaagaccagg
atcagcgtcatccagaaggaggagtttgttttgacaccaatcgaagttgccattgaagac
atgaagaagaagaccctgcagttagcggttgccattaaccaggagccccctgatgccaag
atgcttcagatggtgctgcagggctctgtcggagctactgtcaatcagggaccactggaa
gtagcccaagtatttttggccgaaattccagctgacccaaaactctatcgacatcacaac
aagttgagattatgctttaaggaattcataatgcgatgcggtgaagccgtggaaaaaaac
aagcgtctcatcacgacagaccagagggagtaccagcaggaactcaaaaagaactacaac
aagctgaaagagagcctcaggccaatgattgagcggaaaatcccagaactctacaagccg
ctgttcagagttgagagtcaaaagagagactccttccacagatctagtttcaggaaatgt
gaaacccagttgtcacagggcagctga

DBGET integrated database retrieval system