KEGG   Camelus dromedarius (Arabian camel): 105107022Help
Entry
105107022         CDS       T04642                                 

Gene name
EXOSC10
Definition
(RefSeq) exosome component 10
  KO
K12591  exosome complex exonuclease RRP6 [EC:3.1.13.-]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    105107022 (EXOSC10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cdk03019]
    105107022 (EXOSC10)
Enzymes [BR:cdk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.-  
     105107022 (EXOSC10)
Messenger RNA biogenesis [BR:cdk03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Exosome cofactors
     105107022 (EXOSC10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_pol_A_exo1 PMC2NT HRDC
Motif
Other DBs
NCBI-GeneID: 105107022
NCBI-ProteinID: XP_010999128
Position
13
AA seq 889 aa AA seqDB search
MAPPSPRESKAQSATSAANWAADGEMVLPGFPDADSFVKFALGSVVAVTKASGGLPQFGD
EYDFYRSFPGFQAFCETQGDRLLQCMSRVMQYHGCRSNIKDRSKVTELEDKFDLLVDTND
VILERVGILLDEAAGVNKNQQPVLPAGLQAPTTVVSSWNRKAGEYSKKTKSETFRLLHAK
NIIRPQLKFREKIDNSNTPFLPKIFIKPNAQKPLPQALSKERRERPQDRPEDLDVPPALA
DFIHQQRTQQVEQDMFAHPYQYELDHFTPPDSVLQKPEPQLYRPVEETPCHFVSSLDELV
ELNEKLLNCQEFAVDLEHHSYRSFLGLTCLMQISTRTEDFIVDTLELRSDMYILNESLTD
PAIVKVFHGADSDIEWLQKDFGLYVVNMFDTHQAARLLNLGRHSLDHLLKLYCSVESNKQ
YQLADWRIRPLPEEMLNYARDDTHYLLYIYDKMRLELWERGNEQPVQLQVVWQRSRDICL
KKFIKPIFTDESYLELYRKQKKHLNTQQLTAFQLLFAWRDKTARREDESYGYVLPNHMML
KIAEELPKEPQGIIACCNPVPPLVRQQINEMHLLIQQAREMPLLKSEVAAGARRSGPQPT
PERLENVLFGPHDCSHAPSDGYPLVPASGPEPAQKQDGLLPGREDGEALLDTRCLIATAV
ITLFNEPSAEENGKGPLTIAQKKAQNIMESFENPFRMFLPSLEHRAHISQAAKFDPSSKI
YEISNRWKLASQVQVQKESKELAKKKAAERTAARDQAEEEYKATAEQAVSVRQQAALENT
AKKRERTMSDPRTTEQKQEKKRLKTSKKPKDPDPPEKEFTPYDYSKSDFKAFAGNSKSKP
SPQFDPNKQPQSGKKCLAAKKIKQSMGNKSMSFPTGKSDRGFRHNWPKR
NT seq 2670 nt NT seq  +upstreamnt  +downstreamnt
atggcgccccccagtccccgagagtccaaggcccagtcggcgacgagcgcagccaactgg
gcagcagacggggagatggtgctgccgggcttcccggacgcagatagcttcgtgaagttt
gctcttgggtcagtggtggcagtcaccaaggcatctgggggcctaccacagtttggtgat
gagtatgatttttaccgaagttttcctggcttccaggcattttgtgaaacacagggagac
aggttgcttcagtgcatgagtagggtaatgcagtaccatgggtgtcgaagtaacattaag
gaccggagtaaagtgactgagttggaggacaagtttgatttgctagttgataccaatgat
gttattctggaaagagtgggtatcttactggatgaagcagcaggtgtgaataagaatcaa
cagcctgtcctccctgcaggattacaggcccccacaacagtggtgtccagctggaaccgg
aaggcaggagaatatagcaaaaaaacaaaatctgaaactttccggctgcttcatgcaaaa
aacatcatccgacctcagcttaaattccgagaaaagattgacaattccaacacgccattc
cttcccaaaatcttcatcaagcccaatgctcagaaacccctccctcaggcactctctaaa
gaaaggcgggagcgcccacaggatcgccctgaggacttggatgtgccccctgccctggcg
gacttcatccatcagcagagaacccagcaggtggagcaggacatgtttgcacatccttat
caatacgaactagatcacttcactccaccagattcagtccttcaaaagccagagcctcag
ttatacagacctgtagaagagacgccttgtcattttgtgtcctcgctggatgaactagtg
gagctgaatgaaaagctcttgaattgtcaagaatttgctgtagacttggagcatcactct
tacaggagcttcctggggctgacctgcctgatgcagatttccacccgcacagaagacttc
atcgttgacaccctggagcttcgaagtgacatgtacattctcaatgagagcctcacagac
ccagctattgttaaggtcttccatggtgctgattcagacatagaatggctgcagaaggac
ttcgggttgtatgtggtgaacatgtttgatacccatcaggcagcacgccttctcaacctg
ggcaggcactccctcgatcacctgctgaagctctactgcagtgtggagtcaaacaagcag
tatcagctggctgattggagaatacgacctctgcctgaggaaatgctcaactacgcccgg
gatgacactcattacctgctttacatttacgataaaatgaggctggaactgtgggagcga
ggcaatgagcagcccgtccagctgcaggtggtgtggcagcggagcagggacatctgcctc
aagaaattcatcaaacctatcttcacggatgaatcttaccttgaactatacaggaagcaa
aagaagcacctcaacacgcagcagctgacggcctttcagctgctgtttgcctggagggac
aagaccgctcgtcgggaggatgaaagttatggatatgtcctgccaaaccacatgatgcta
aagatagctgaagagctgcctaaggaacctcagggcatcatagcttgctgtaaccctgta
ccaccccttgtacggcagcagatcaatgaaatgcatcttttaattcagcaggcccgggag
atgcctctgctcaagtctgaagtcgcagctggagcgaggaggagcgggccgcagcccacc
cctgagaggttggagaacgttctctttggccctcacgactgctcccacgccccgtcagat
ggctatcctctcgtcccagccagcggacctgagccagcacagaaacaggacggcctcctc
cccggccgagaagacggggaggctctgctggacaccagatgcctcatcgccaccgctgtc
atcacgttgtttaacgaacctagtgctgaagaaaacggaaagggtccattaacaatagca
cagaagaaagcccagaacataatggagtcctttgaaaatccatttaggatgtttctgcct
tcactagaacaccgggctcatatttctcaggctgcaaagtttgatccgtcatcaaaaatc
tatgaaatcagcaaccgttggaagctggcaagccaggtacaggtacaaaaagagtctaaa
gaacttgccaagaagaaggcagctgagcgaacagccgcccgggaccaggccgaggaggag
tataaagcaacagcagagcaggccgtgtctgtccgccagcaggccgccctggagaacact
gccaagaagagagagcggacaatgagtgatccaaggacgacagaacagaaacaggagaag
aaacgactgaaaacttccaagaagccaaaagacccagatccaccagaaaaagagtttacc
ccttacgactacagcaagtcggatttcaaggcttttgctggaaacagcaaatccaaacca
tctccccagtttgacccaaataagcagccccagtccggcaagaaatgccttgcagccaaa
aaaattaaacagtcgatgggaaacaaaagcatgtcctttccaacgggaaagtcagacaga
ggtttcaggcacaattggccaaagagatag

DBGET integrated database retrieval system