KEGG   Clostridioides difficile R20291: CDR20291_0389
Entry
CDR20291_0389     CDS       T00998                                 

Gene name
oraE
Definition
(GenBank) D-ornithine aminomutase E component
  KO
K17898  D-ornithine 4,5-aminomutase subunit beta [EC:5.4.3.5]
Organism
cdl  Clostridioides difficile R20291
Pathway
cdl00472  D-Arginine and D-ornithine metabolism
cdl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    CDR20291_0389 (oraE)
Enzymes [BR:cdl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     CDR20291_0389 (oraE)
SSDB
Motif
Pfam: Lys-AminoMut_A OAM_dimer B12-binding
Other DBs
NCBI-ProteinID: CBE02140
UniProt: C9YIJ5
Position
465801..468005
AA seq 734 aa
MLKENKKLDIDYILKDLDKYKPKRRGWVWREHLENLEMGPFKYKDCTKPLKKSVGLPSSK
YFNNIDPQPSPVITTEIASGRFEDDIRRMRMAAHHGADHLMVIRTAGQSHFDGLIEGTPQ
GIGGVPITRKQVRAQRKALDFIEEEVGRPINYHSYVSGVAGPEVAVMFAEEGVNGAHQDP
QYNVLYRNINMVRSFVDACEAKKIMAFANIAQIDGAHNANATAREAWKVMPELMVQHALN
SIFSEKIGIDKSNICLSTVPPTAPPAPCLRIDLPYAVALRELFSDYKMRAQMNTKYMESS
TREATVTHVLNLLTSVLTRADIQSTITPDEGRNVPWHIYNIEACDTAKQALVGMDGLMDM
IELKDVGELRDKARELKERAVLYMEEISEVGGYFESVEQGFFVDSGNYPERNGDGISRKI
KGGVGEGTVYEREEDYLAPVTAHFGYNNVAQYDENAIDNPSMLIDGCTFENPDKIIYIDE
LDDFDNVENRLKESYEYRNGTKIKPEMEWCADGIVMITMMLPTDKRTAEFAALEFVKKMN
LQEIEVISREVMHESEGTRIEVKGRVPFDIDLNNLVIPEEPKVLTDEEIRADIEEKPMKI
VSATVGEDEHSVGLREIIDIKHGGIEKYGIECHYLGTSVPVEKLVDAAIELNADAILAST
IISHDDIHYKNMKKLHDYCVEKGIRDKVMIACGGTQVTPEIAVEQGIDAGFGRNSKGIHV
ATFLVEKRREMSNK
NT seq 2205 nt   +upstreamnt  +downstreamnt
atgttaaaggaaaataaaaaattggatatagactatatattaaaagatttggataaatat
aaaccaaaacgaagaggttgggtttggagagaacacttggaaaatcttgaaatgggacct
tttaaatataaagactgtacaaaacctttaaagaagagtgtagggctaccatcatctaag
tatttcaataatatagaccctcaaccaagtccagttattactactgaaatagcttctggt
agatttgaggatgatataagaagaatgagaatggcagctcatcatggagctgaccatcta
atggttatcagaactgctggacaatcacattttgatgggcttatagaaggaactccacaa
ggtataggtggagttccaataacaagaaaacaagtaagagctcaaaggaaggctcttgat
tttatagaagaagaagttggtagacctattaattaccattcatatgtaagtggtgttgct
ggtcctgaagtagcagtaatgtttgctgaggaaggagtcaatggagcacatcaagaccca
caatataatgttctgtataggaatataaacatggtaaggtcttttgtagatgcttgtgag
gcaaagaaaataatggcttttgccaatatagctcaaattgatggagcacataatgctaat
gctactgctagagaagcatggaaggtaatgcctgaacttatggttcaacacgctttaaac
tctatattctcagaaaaaataggtatagataaaagtaatatatgcttatcaacagttcca
ccaacagcacctccagcaccatgtttaagaatagacttaccttacgctgttgcacttaga
gaattatttagtgattataagatgagagctcaaatgaatactaaatatatggaatcatca
actagagaagcaacagttactcatgtattaaacttattaacatcagtattaactagagct
gacatacaatcaactataacacctgatgaaggtagaaatgtaccttggcatatatacaat
atagaagcatgtgatacagcaaagcaagctttagttggtatggatgggcttatggatatg
atagaacttaaagatgtcggtgaattaagagacaaagcaagagaacttaaagaaagagct
gtattatatatggaagaaatatctgaagttggtggatattttgaatctgtggaacaagga
ttttttgttgattctggaaattatccagaaagaaatggtgatggaatatctagaaaaata
aaaggtggagttggtgaaggtactgtttatgaaagagaagaagattatttagcacctgta
actgctcactttggatacaataatgtagctcaatatgatgaaaatgctatagataatcca
tcaatgttaatagatggatgtacatttgaaaatccagacaaaataatatatattgatgag
cttgacgattttgataatgtagaaaatagactaaaagaatcatatgagtacagaaatgga
actaaaattaagcctgaaatggaatggtgtgcagatggaattgtaatgataacaatgatg
cttcctactgataaaagaacagcagagtttgcagctttggaatttgtcaaaaaaatgaac
ttacaagaaattgaggtcataagtagagaagttatgcatgaatctgaagggactagaata
gaagtgaaaggaagagttccgtttgatatagatttaaacaatttagtaataccagaagaa
cctaaggtactaactgatgaagaaataagagcagatatagaagaaaaacctatgaaaata
gtttcagctacggttggagaagatgaacattcagttggtttaagagaaataatagatata
aaacatggaggtattgaaaaatatggcatagaatgccactatctagggacttctgtacct
gtagaaaaattggtagatgcagcgattgaactgaatgcagatgcaatacttgcatctaca
ataataagtcatgatgatattcactataaaaacatgaaaaaattacacgattattgtgta
gaaaaaggtataagagataaagtaatgattgcgtgtggaggaacacaagtaacacctgaa
atagctgttgaacaaggcatcgatgctggatttggaagaaacagcaaaggcatacatgta
gccactttcttagttgaaaaaagaagagaaatgagtaataaataa

DBGET integrated database retrieval system