KEGG   Clostridioides difficile R20291: CDR20291_2175Help
Entry
CDR20291_2175     CDS       T00998                                 

Definition
(GenBank) sugar phosphate aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
cdl  Clostridioides difficile R20291
Pathway
cdl00051  Fructose and mannose metabolism
cdl01100  Metabolic pathways
cdl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cdl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    CDR20291_2175
Enzymes [BR:cdl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     CDR20291_2175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: CBE05290
UniProt: C9YNL6
Position
complement(2558761..2559408)
Genome map
AA seq 215 aa AA seqDB search
MLDSLKGKVVEIAIKAEHYGLCKEKTGNFSIRDKDTGYILITPSGIGREELNVEHICVLD
LNGNVIEVEKGIKPSSEVLMHIEIYKIRENINAISHTHSLYATAFSVAKKPIIPIVYESV
NYGGYVDIAPYERPGTLKLAKSVSKLLIDTDACLLERHGLTTVGNDLDEALLKSRYVEEV
AEIYYRSLVLNQFKELEVVDVDEFESWKYPEEIKF
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgctagactctttaaaaggtaaagttgtggaaatagcaattaaagcagagcattatggt
ttatgtaaagaaaagactggtaattttagtattagagataaggatactggatatatactt
ataaccccatcaggtataggaagagaagaattaaacgttgaacatatttgtgtattggat
ttgaatggaaatgtaatagaagttgagaaaggtattaagccaagtagtgaggtattgatg
catattgaaatatataaaataagggaaaatataaatgctatatcacatactcattcttta
tatgcaacagcattttcagtagcaaagaaaccaattataccaattgtatatgaatcagtt
aattatggcggttatgtagatattgctccatacgaaagaccaggaactttaaaattagct
aagagcgtttcaaaattactgatagatacagatgcatgcttattagaaagacatgggttg
acaactgtaggtaatgatttagacgaagcattattaaaatcaagatatgttgaagaggta
gcagaaatatactataggtctttagtattaaatcaatttaaagaacttgaagtagtagat
gttgatgagtttgaatcttggaaatacccagaagaaataaagttttaa

DBGET integrated database retrieval system