KEGG   Clostridioides difficile R20291: CDR20291_2744Help
Entry
CDR20291_2744     CDS       T00998                                 

Gene name
dltA
Definition
(GenBank) D-alanine--poly(phosphoribitol) ligase subunit 1 (D-alanine-activating enzyme)
  KO
K03367  D-alanine--poly(phosphoribitol) ligase subunit 1 [EC:6.1.1.13]
Organism
cdl  Clostridioides difficile R20291
Pathway
cdl00473  D-Alanine metabolism
cdl01100  Metabolic pathways
cdl01503  Cationic antimicrobial peptide (CAMP) resistance
cdl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cdl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CDR20291_2744 (dltA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CDR20291_2744 (dltA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    CDR20291_2744 (dltA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:cdl01504]
    CDR20291_2744 (dltA)
Enzymes [BR:cdl01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.13  D-alanine---poly(phosphoribitol) ligase
     CDR20291_2744 (dltA)
Antimicrobial resistance genes [BR:cdl01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon [MD:M00725]
    CDR20291_2744 (dltA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C AA_synth baeRF_family6
Motif
Other DBs
NCBI-ProteinID: CBE06297
UniProt: C9YQ79
Position
complement(3248642..3250156)
Genome map
AA seq 504 aa AA seqDB search
MKIIEGIKKYSNTDRTALMCNGDKLSYKDLNEYSDAISVFLKDVYKEEDTPIVIYGNKEN
MIMACMIGALKSGRAYVPLDISFPIDRVFEVTKEIKPKVIFNFSDERNFGDINVIDMDKL
NDIINEYQGKSLDKENWVKDDENAYILFTSGSTGKPKGVQISSNNLDSFSDWISPYLNID
GSEKVIMNQPAYSFDLSVTTIYPGLIHGATLFSISKDVLADYKELFRQFSISDIAVWVST
PSFAGVCITEKEFNSKMLPNLESMIFIGEALSKNLTKELMSRFPNTRIINGYGPTEATVG
VSVNDMTQKAIDDEKSLPVGYPMSNCKIKILDEDGNELKENEKGEIIIIGPSVSKGYFNN
KEKTDEVFFYDEIDGVKWRAYKTGDMGYLLDGNIYYCGRKDFQIKLNGFRIEIEDIENNL
RKVHNVKNAVVLPVYKDEKIAYLKGIVELNEKNDLSNIKNGMIIKKELGKYIPSYMIPRN
ISIISEFPTNINGKIDRKKLMEEI
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattattgaaggaataaaaaaatattcaaatacagatagaacagcactaatgtgt
aatggagataaactttcttataaagatttaaatgaatattcagatgctatatcagtattt
ctaaaggatgtatacaaagaagaggatactcctatagtaatttatggaaataaagaaaac
atgataatggcatgtatgataggagctttaaaatcaggtagagcgtatgtgcctcttgat
attagttttccaattgatagagtttttgaagtcactaaagagataaaaccaaaagtaata
tttaattttagtgatgaaagaaattttggagatatcaatgtaattgatatggataaatta
aatgatataataaatgaatatcagggaaaatcattagataaagaaaactgggtaaaagat
gatgaaaatgcatatatactatttacttcaggaagtacaggaaagccaaaaggggttcaa
ataagttcaaacaatttagatagcttttcagattggataagcccatatctaaacatagat
ggaagtgaaaaagtaataatgaaccaaccagcatattcttttgacctttcagttacaaca
atataccctggtcttatccatggagctacattattttcaatatcaaaagatgtattagca
gactataaagaactatttagacaatttagtatctcagatatagctgtatgggtgtcaact
ccttcttttgcaggagtatgtataactgaaaaagagtttaatagtaaaatgcttcctaac
cttgagtcaatgatattcataggagaagcactttcaaaaaatcttactaaagaacttatg
agtagatttccaaacacaagaattatcaatggatatggaccaaccgaggctactgttggt
gtaagtgtaaatgatatgactcaaaaagctatagatgatgaaaaaagtcttccagttgga
taccctatgtcaaattgtaaaataaaaatacttgatgaagatggaaatgaacttaaagaa
aatgaaaagggtgaaattataataattggaccatcagtttctaaaggttacttcaataat
aaagaaaagactgatgaagtatttttctatgatgaaatagatggtgtaaagtggagagct
tataaaactggagatatgggatatcttttagatggaaatatatattattgtggaagaaaa
gattttcagattaaattaaatggatttagaattgaaatagaagatatagaaaataatttg
agaaaagtacataatgtaaaaaatgcagtagttttaccagtatataaggacgaaaaaatt
gcttacttaaaaggtattgttgagttaaatgaaaagaatgatttaagtaatattaaaaat
gggatgataataaaaaaggaacttggaaagtatataccttcatatatgattccaagaaat
atttcaataatctctgagtttccaacaaatatcaatggtaaaatagacagaaagaaactt
atggaggaaatttaa

DBGET integrated database retrieval system