KEGG   Clostridioides difficile R20291: CDR20291_2805Help
Entry
CDR20291_2805     CDS       T00998                                 

Definition
(GenBank) putative thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cdl  Clostridioides difficile R20291
Pathway
cdl00071  Fatty acid degradation
cdl00072  Synthesis and degradation of ketone bodies
cdl00280  Valine, leucine and isoleucine degradation
cdl00310  Lysine degradation
cdl00362  Benzoate degradation
cdl00380  Tryptophan metabolism
cdl00620  Pyruvate metabolism
cdl00630  Glyoxylate and dicarboxylate metabolism
cdl00640  Propanoate metabolism
cdl00650  Butanoate metabolism
cdl00900  Terpenoid backbone biosynthesis
cdl01100  Metabolic pathways
cdl01110  Biosynthesis of secondary metabolites
cdl01120  Microbial metabolism in diverse environments
cdl01130  Biosynthesis of antibiotics
cdl01200  Carbon metabolism
cdl01212  Fatty acid metabolism
cdl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cdl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CDR20291_2805
   00630 Glyoxylate and dicarboxylate metabolism
    CDR20291_2805
   00640 Propanoate metabolism
    CDR20291_2805
   00650 Butanoate metabolism
    CDR20291_2805
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CDR20291_2805
   00072 Synthesis and degradation of ketone bodies
    CDR20291_2805
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CDR20291_2805
   00310 Lysine degradation
    CDR20291_2805
   00380 Tryptophan metabolism
    CDR20291_2805
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CDR20291_2805
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CDR20291_2805
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CDR20291_2805
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cdl04147]
    CDR20291_2805
Enzymes [BR:cdl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CDR20291_2805
Exosome [BR:cdl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CDR20291_2805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CBE06396
UniProt: C9YQE0
Position
complement(3321265..3322401)
Genome map
AA seq 378 aa AA seqDB search
MKEVFILGGLRSHIGLKNGIFQFVQPELLGASVLKDLIKKYEIDKIDEIICGNAVGTGGN
IARLMTLTAGVSNEVPAFTVDMQCASAMMSIDIAFSKVKSGQCNLIIAGGFESSSLQPMR
TYHKNDKRYNTNNPNYTVAQFSPDDNSQNSMLEGAERVAELYQIERADLDFWVKESHKRA
KEAREEKILEDIISPINNSTYDEGIRDKMSQRLLDRMPPILGKETITNAANSCLINDGAS
FIIICSKKYLEHVKKKPKTKIINTCTIGTDATLSPTSAIQAMDKLLEIESLNYLDVSAVE
FNEAFAVIDVLFQRKYPELIERYNIFGGALAYGHPYGASGAIITLHLLKALEKTKGRYGI
CSIAAAGGLGSALLLERV
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaagtttttatattaggaggattgagaagtcatataggtctaaaaaatggaatt
tttcaatttgttcaacctgaattactaggagcaagtgttttaaaagatttaattaaaaag
tatgaaattgacaaaattgatgagattatatgtggaaatgcagttgggacaggagggaat
atagccagattaatgactttaacagcaggagtgtcaaatgaagtacctgcttttactgtg
gatatgcagtgtgcttctgctatgatgagtatagacatagctttttcaaaggttaaatct
ggtcagtgtaatttaattattgcaggtggttttgaaagtagttctctacaaccaatgcgc
acatatcataagaatgataagcgatataatacaaataatccaaattatacagttgctcaa
ttttctcctgatgataatagtcaaaatagtatgctcgaaggggcggaaagagtagcagag
ttatatcaaattgagagagcagacttggatttttgggtaaaggaaagtcataaaagagca
aaagaagcaagagaagaaaaaatacttgaggatattatatctcctataaataatagtacc
tatgatgaaggtatacgtgataagatgagtcaaaggttattagataggatgccaccaatt
ttaggaaaagaaactattacaaatgcagcaaattcatgtcttattaatgatggagcttca
tttattataatatgttctaagaagtatttagaacatgtaaaaaagaagcctaaaacaaaa
attattaatacatgcacaataggaacagatgcaaccttaagtccaacatcagcgatacaa
gcaatggataaacttttagagatagaaagccttaattatttagatgtatctgctgttgaa
tttaatgaagcatttgcagttatagatgtgttgtttcaaagaaagtatccagagttaata
gagagatataatatatttggtggagctttagcgtatggacatccatatggtgcttcaggt
gcaattattacattacatcttttaaaagcattagaaaaaactaagggtagatatggaatt
tgctctatagctgcagctggtggtctaggttcagctttactgcttgaaagggtgtag

DBGET integrated database retrieval system