KEGG   Clostridioides difficile R20291: CDR20291_3253Help
Entry
CDR20291_3253     CDS       T00998                                 

Definition
(GenBank) putative cobalamin biosynthesis kinase
  KO
K16651  L-threonine kinase [EC:2.7.1.177]
Organism
cdl  Clostridioides difficile R20291
Pathway
cdl00860  Porphyrin and chlorophyll metabolism
Brite
KEGG Orthology (KO) [BR:cdl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CDR20291_3253
Enzymes [BR:cdl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.177  L-threonine kinase
     CDR20291_3253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: CBE07196
UniProt: C9YRN5
Position
complement(3886773..3887660)
Genome map
AA seq 295 aa AA seqDB search
MKSYGICPASCGEFVQGIIDDEEYLCSYAIDMYSEVYIEEKLVDINLGRYKSRLAIEKVF
EKFNLPKKYTKNISLNINSKIPVGKGMASSTADIGATIKATLSLIDKDLSSEEISKLAAE
IEPTDSIFIDKNSIFNPLNGTVIKYLGNLTNAKVIILEPNKVLDTMKIRLRQDYNKLKVE
NKEVIKKSFALLEEGLKKNNLSLVGEACTLSSLANENIEKKEYLNEIIKISKKYGAYGVN
IAHSGTVVGILIDKSMNDKKMIDTLCESNINSVYNKIYTQNIINGGIKGEIEWNT
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcttatggaatatgcccagcatcttgtggagaatttgtacaaggtataattgat
gatgaagaatatttatgttcatatgcaatagatatgtattctgaagtgtatattgaagaa
aaattagtagatataaatttagggagatataagtcaaggttagcaattgaaaaggtattt
gaaaaatttaatttacctaaaaaatatactaaaaatatttctttaaatataaatagtaaa
atacctgttggaaaaggaatggcaagttcaactgctgatataggagctacaataaaggca
acattatcattgatagataaagatttaagtagtgaggagatttctaaattagcagcagaa
atagaaccaacagattctatatttatagataaaaatagtatatttaatcctctaaatgga
actgttataaaatacctaggaaatctgaccaatgcgaaagttataatacttgaaccaaac
aaagtactagatactatgaaaattagattgaggcaagattataataaattaaaagtagaa
aataaagaagtaataaaaaaatcatttgctcttttagaagaaggattgaaaaaaaataat
ttatctctagttggagaggcttgtactttgagtagcttagcaaatgagaatatagaaaaa
aaagagtatttaaatgaaataataaaaatatcaaaaaaatatggagcatatggagtaaat
attgctcacagtggaactgtagtaggtattttaattgataagtctatgaatgataaaaag
atgatagataccttatgtgaatctaacataaattctgtctataataaaatttatacacaa
aacataattaatggaggaattaagggggaaatagaatggaatacataa

DBGET integrated database retrieval system