KEGG   Clostridioides difficile R20291: CDR20291_3275Help
Entry
CDR20291_3275     CDS       T00998                                 

Gene name
agaA
Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
cdl  Clostridioides difficile R20291
Pathway
cdl00520  Amino sugar and nucleotide sugar metabolism
cdl01100  Metabolic pathways
cdl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cdl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CDR20291_3275 (agaA)
Enzymes [BR:cdl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     CDR20291_3275 (agaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: CBE07235
UniProt: C9YRQ7
Position
3911222..3912343
Genome map
AA seq 373 aa AA seqDB search
MKHGIKEKGYLSIINGKFGEFQQERPNITDNVIDFSGKYIAPGLVDTHIHGLLGADVMDN
TFEAINTISKGLLKYGVTSFLPTTLTDSVDTLSDSVENISNSFNRVEGAKIQGIYLEGPF
FTEKYKGAQNEKYFKDPDINILKLWQRKSKNLIRKIAIAPERKGSIELTRYATKNNISVS
LGHSSATFEQVKQVVNSGAKVFVHTYNGMSPLNHREPGMVGAAMVLKDTYAELICDGHHV
SPIAVKIMMDAKSSNNIALITDCMRAGAMEDGKYTLGKFSVNVKNSVARLNSGSLAGSVL
TMDKAVRNIVDWNIATLEDAIKMATYVPALSCNIDNVCGSIHQGMDADFIVTDKNFNIYE
TYISGICMYKVNK
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgaaacatggaatcaaagaaaaaggttaccttagtataattaatggcaaattcggtgaa
tttcaacaagaaagacctaatattactgataatgtcatagatttttcaggtaaatatatt
gctcctggcttagttgatactcacattcacggtcttttaggtgcagatgtcatggacaat
acatttgaagcaataaacacaatttcaaaaggcttattaaaatatggagtaacatctttc
ctacctacaactttaactgattctgtagatacactaagtgattctgtagaaaatataagc
aatagcttcaatcgagttgagggtgcaaaaatacaagggatttatttagaaggtccattt
tttacagaaaaatataagggcgctcaaaatgaaaaatattttaaagaccctgacatcaat
atattaaaattatggcaaagaaaatcgaaaaatttaataagaaaaatagcaattgctcca
gaacgtaaaggttcaatagaattaacaagatatgcaactaaaaataatatctctgtttct
cttggccatagttcagctacatttgaacaagttaaacaagtcgttaattcaggtgctaaa
gtgtttgtacatacatataatgggatgagccctttaaatcatagagaacctggaatggtt
ggggctgctatggtactaaaagatacttatgctgaattaatttgtgatggtcatcatgta
agcccaatagctgttaaaataatgatggatgcgaagtctagtaataacatagctttaatt
acagattgtatgagggctggtgctatggaggatggaaaatatactcttggtaagtttagt
gtaaatgtaaaaaatagtgttgcaagattaaatagtgggagtttagctggaagtgtatta
actatggacaaggctgtgagaaatatagttgattggaacatagccactttagaagatgca
ataaaaatggctacatatgttcctgctttaagttgtaatattgataatgtctgtggctcc
atacatcaaggtatggatgcagactttatagtaacagataagaactttaatatatacgaa
acttatataagtggtatatgtatgtacaaagttaataaatag

DBGET integrated database retrieval system