KEGG   Cronobacter dublinensis: AFK67_06145Help
Entry
AFK67_06145       CDS       T04061                                 

Gene name
nagA
Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
cdm  Cronobacter dublinensis
Pathway
cdm00520  Amino sugar and nucleotide sugar metabolism
cdm01100  Metabolic pathways
cdm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cdm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AFK67_06145 (nagA)
Enzymes [BR:cdm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     AFK67_06145 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: ALB66072
UniProt: A0A0K2P0I9
Position
complement(1339994..1341142)
Genome map
AA seq 382 aa AA seqDB search
MYALTHGRIYTGHDILDDHAIVIADGLIERLCPLADLPAGIEQRDMGGAIIAPGFIDVQL
NGCGGVQFNDTADAVSVDTLEIMQKANEKSGCTSYLPTLITCSDALMKQGVRVMRDYLAH
HKNQALGLHLEGPWLNIVKKGTHNPDYVREPDAELVDYLCENADVITKITLAPERVAPEV
IAKLTAAGIVVSAGHSNATLKEAKKGFRAGIRFATHLFNAMPYITGREPGLTGAIFDEPD
VFCGIIADGLHVDFANVRLAKKVKGDKLCLVTDATAPAGANIDEFIFAGKTIYYRNGLCV
DENGTLSGSALTMIEGVRNLVEHVNIALDEALRMATLYPARAMGVAHRLGSVEAGKVANL
TAFTRDYKIIKTIVNGNEVVTE
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgtacgctttaacccatggccggatttataccggtcacgacattctggatgaccacgcg
attgttatcgccgatggcctgattgagcgcctgtgcccgctggctgacctgccagcaggg
atcgagcagcgcgatatgggcggcgccatcatcgcccccggttttatcgacgtgcagctg
aacggctgcggtggcgtgcagtttaacgacacggcagacgccgtctcggtcgacacgctg
gaaatcatgcaaaaggccaatgagaaatcgggctgcaccagctatctgccgacgctgatc
acctgtagcgatgcgctgatgaaacagggcgtgcgcgtgatgcgcgactacctggcgcac
cataaaaaccaggcgctcggtctgcaccttgaaggcccgtggctgaatatcgtcaaaaaa
ggcacgcataacccggattatgtgcgtgagccggacgcggaactggtggattatctgtgt
gagaacgccgatgtcatcaccaaaatcacgctcgcgccggaacgcgtcgcgccggaggtt
attgcaaaactgacggccgctggcatcgtggtctccgccgggcactccaacgcgacgctg
aaagaagcgaaaaaaggcttccgcgccgggatccgctttgccacgcacctttttaacgcg
atgccgtatatcaccggccgcgagcctggccttaccggcgcaatctttgacgagccggat
gtcttttgcggcattatcgccgacggcctgcacgtggatttcgcgaacgtgcgtctcgca
aaaaaggtaaaaggcgacaaactttgtctggtgaccgatgcaacggcgcccgcaggtgcc
aatattgatgagttcatttttgctggtaaaacaatatactaccgcaatggcctgtgcgtg
gacgagaacggcaccctcagtggttcggcgttgaccatgatcgaaggcgtgcgcaacctg
gtggagcatgtcaatatcgcactggacgaagcgctgcgtatggcgacgctttatccggct
cgcgccatgggcgtggcgcaccggcttggcagcgttgaagcgggcaaagtggcgaatctc
accgcctttacccgcgattataaaatcatcaagaccatcgttaatggtaacgaggtcgtt
actgagtaa

DBGET integrated database retrieval system