KEGG   Cronobacter dublinensis: AFK67_08670Help
Entry
AFK67_08670       CDS       T04061                                 

Definition
(GenBank) beta-D-glucoside glucohydrolase
  KO
K17641  beta-xylosidase
Organism
cdm  Cronobacter dublinensis
Brite
KEGG Orthology (KO) [BR:cdm00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99981 Carbohydrate metabolism
    AFK67_08670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 Glyco_hydro_3_C Fn3-like DUF11 CARDB DUF4232
Motif
Other DBs
NCBI-ProteinID: ALB66553
UniProt: A0A0K2P1C7
Position
1885725..1888094
Genome map
AA seq 789 aa AA seqDB search
MTIYKDPTRPVAERVADLLARMTPEEKFAQMHAYWLVLSPEGDHRERTDLSDEFSGATQQ
AALTERLKRGAGQITRPLGTHIVAPREGVRAANRLQKMLVEETRLGIPAMFHEECLVGLL
CKDATLFPSSLNYGSTWDPQLVEQAAQAIGREARAVGCHQGLAPVLDVSRDVRWGRTEET
FGEDPWLVGVMATRYVKGLQGPQRDLLATLKHYVGHSFSEGARNHAPVHLGFCELNDTFL
LPFEMAVKLAHAGSVMPAYHDIDNVPTHADDFLLTQVLREQWGFDGIIVADYGGVSLLHQ
HHGVAQDAAHSAALAFNAGLDIELPKDDCARHLAQALARGLITMEKVDKIVARVLGEKFR
LGLFEQPYADENAITLQSDETRRIAREVAARSLTLLENNGVLPLQGTPRVAVVGPTADDP
LALLSGYSFPVHLIISDMLEQTSQVTTPLAALREQLGGALAGYAKGCHIIEKRMAGAPVF
PGDSGEKPMQQSPVSDDVSLIPDAVALAGQSDVVLAFVGDLSGLFQSGTVGEGSDTDSLQ
LPGVQQQLLEALVETGKPVVVVMTGGRPYHLGGLESRVAAWVMAWAPGQEGGHAIADLLT
GKAEPQGRLVVSVPKSAGAMPYYYNHKLKSGGTPYAFHFGSRYPFGYGKTWTEFRYGALD
IAQARVPMAGEVEVSVTVTNSGAQAGSEVVQLYVHDKVASMVRPVQELKAFGRVTLAPGA
SARVTFRVPVDMLSFTRRDGARIVEPGEFDIRVGANSGDIRSRGTVIVEGETQVLGNSWR
MLSECHVEQ
NT seq 2370 nt NT seq  +upstreamnt  +downstreamnt
atgactatctataaggacccaacccgtccggtggctgaacgcgtcgccgatttgctcgcc
cgcatgacgccggaggagaaattcgcccagatgcacgcttactggctggtgctgtcgccg
gagggcgatcaccgggagcgaaccgatttgagcgatgagttttccggcgcgacccagcag
gcggcgctgaccgaacgtctgaaacgcggcgcggggcagataacccgcccgctcggcacc
catatcgtcgcgccgcgggagggcgtgcgcgccgctaaccgtctgcagaaaatgctggtg
gaagagacgcggctcggcattcccgccatgttccatgaagagtgcctggtggggctgcta
tgcaaagacgcgacgctgtttccgtcgtcgctcaactacggttccacctgggatccgcag
ctggtggagcaggccgcgcaggctatcgggcgtgaagcgcgcgccgtcggctgtcatcag
ggcctcgcgccggtgctcgatgtgtcgcgcgacgtgcgctggggccgcacggaagaaacc
tttggcgaagatccgtggctggtgggcgtgatggcgacccgctacgtgaaagggctacag
gggccgcagcgggatctgctcgcgaccctcaagcactacgtcggccactcgttcagcgaa
ggcgcgcgcaaccatgcgccggtgcacctcggcttttgcgaactcaacgacaccttcctg
ctgccgtttgaaatggcggtgaagctggcgcacgcgggctcggtgatgcctgcgtatcac
gatatcgataacgtgccgacccacgccgatgatttcctcctcacacaagtattgcgcgaa
caatggggctttgacggcattatcgtcgccgactacggtggtgtaagcctgctgcatcag
caccacggcgtggcgcaggacgcggcgcactcggcggcgctggcctttaatgcggggctg
gatatcgaactgccgaaagacgactgcgcgcgccatctggcgcaggcgctggcgcgcggg
cttatcacgatggaaaaagtggataaaattgtggcgcgcgtgctgggcgaaaagttccgt
ctcggactgtttgaacagccgtatgccgatgagaacgccattacgctgcaaagcgacgag
acgcgccgcatcgcccgcgaggtggcggcgcgttccctgacgctgcttgagaataacggt
gtgctgccgcttcagggtacgccgcgcgtggcggtagtcgggccgacggcggacgatccg
ctggcgctgctgagcggctacagcttcccggtgcatctcatcatcagcgatatgctggag
cagacaagccaggtgacgacgccgcttgccgcgctgcgcgaacagctcggtggcgcgctc
gcaggctatgccaaaggctgtcatatcattgagaaacgcatggcgggcgcgccggtgttc
cccggcgacagcggcgaaaaaccgatgcagcagtcgccggtctcagacgatgtgtcgctc
atcccggacgcagtggcgctcgccggacaaagcgacgtggtgctggcgtttgtcggcgat
ctctccgggctgttccagagcggcaccgtgggcgaaggctctgacaccgacagcctgcaa
ctgccgggcgtgcagcaacagctgctggaggcgctggtggaaacgggtaagccggtcgtg
gtcgtgatgaccggcggtcgcccttatcacctgggcgggctggagtcgcgcgtcgcggcg
tgggtgatggcctgggcgccggggcaggagggcggacacgcgattgcggatctgctgacc
ggcaaagcggaaccgcagggccggttagtggtgtcggtgccgaaaagcgcaggcgcgatg
ccgtactactacaaccataagctcaaaagcggcggcacgccttacgcgtttcacttcggc
tcacgctacccgttcggctacggcaaaacctggaccgaattccgctatggcgccctggac
atcgcccaggcgcgcgtgccgatggcgggcgaggtggaggtatcggttaccgtcaccaac
agcggcgcgcaggcgggcagcgaggtggtacagctgtatgtgcacgataaagtagcctcg
atggtccgcccggtgcaggagctgaaagccttcgggcgcgttacgcttgcccctggcgcc
agcgcgcgcgttacgttccgcgtgccggtcgatatgctcagtttcacgcgtcgtgatggc
gcacgcattgtcgagcctggcgagtttgacattcgcgttggggccaatagcggcgatatt
cgcagtcgcggcaccgttattgtggaaggcgaaacccaggtgctgggaaatagctggcgg
atgctgagtgagtgtcatgttgagcaataa

DBGET integrated database retrieval system