KEGG   Cronobacter dublinensis: AFK67_13360Help
Entry
AFK67_13360       CDS       T04061                                 

Definition
(GenBank) histidine kinase
  KO
K07642  two-component system, OmpR family, sensor histidine kinase BaeS [EC:2.7.13.3]
Organism
cdm  Cronobacter dublinensis
Pathway
cdm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cdm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AFK67_13360
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cdm01001]
    AFK67_13360
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:cdm02022]
    AFK67_13360
Enzymes [BR:cdm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     AFK67_13360
Protein kinases [BR:cdm01001]
 Histidine kinases
  OmpR family
   AFK67_13360
Two-component system [BR:cdm02022]
 OmpR family
  BaeS-BaeR (envelope stress response)
   AFK67_13360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HAMP HisKA
Motif
Other DBs
NCBI-ProteinID: ALB67413
UniProt: A0A0K2P3T5
Position
2914891..2916315
Genome map
AA seq 474 aa AA seqDB search
MRFWRPGIMGKLFLAIFATCILLLITMHWAVRFSFERGFIDYIKHGNEQRLALLSDALSE
QYQQHGDWGFLRHNDRVVFQILRSFERENAHDGPPPPDRGPPPHMPPHGWRTQFWVVDAD
QTVLVGPRSPVPQDGARRAIVVDGKRVGWVIASPVERLTRSTDINFDKQQRRTSWLIVAL
STLLAAAATLLLARGLLAPVKRLVEGTHRLAAGDFTARVVATGQDELGRLAQDFNQLAST
LEKNQQMRQAFMADISHELRTPLAVLRGELEAIQDGVRQFTPESVASLQAEVGTLTKLVD
DLHQLSLSDEGALAYQKKPLEIVALIEVAAGAFRERFAARGLTLNLSLPENVTLFGDRDR
LMQLFNNLLENSLRYTDAGGGLLIQGECQGARFVLRFSDSAPGVSDEQLAKLFERFYRAE
GSRNRASGGSGLGLAICANIVAAHGGTISADHSSSGGVSITVSLPLDAILPGDV
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgaggttctggcggcccggcattatgggcaagctgtttctggccattttcgctacctgc
attctgctgttaattacgatgcactgggcggtgcgctttagctttgagcgcggctttatc
gactacatcaaacatggcaacgagcagcggctggcgctgctaagcgacgcgctgagcgaa
caatatcagcagcacggcgactgggggtttctgcgccataacgatcgcgtggtgttccag
attttacgctctttcgagcgggagaacgcccacgacggcccgccgccgccagaccggggg
ccgccgcctcatatgccgccgcacggctggcgcacgcagttctgggtggtggacgccgat
cagacggtgctggtcggcccgcgctcgccggtgccgcaggatggcgcgcggcgcgcgatt
gtcgtcgacggcaaacgcgtcggctgggtcatcgcctcaccggtggagcgcctgacgcgc
agcaccgatattaatttcgataaacagcagcggcgcaccagctggcttatcgtcgcgctc
tcgacgctgctggccgcggcggccacgctgctgctggcgcgcggcctgctggcgccggta
aaacggctggtggaaggcacgcaccggctcgcagcgggcgatttcacggcccgcgtcgtc
gccaccggccaggatgaactgggccgtctggcgcaggatttcaaccagctcgccagtacg
cttgagaaaaaccagcagatgcgccaggcctttatggcggatatttcgcacgaactgcgc
acgccgcttgccgtgctgcgcggcgagctggaggcgattcaggacggcgtgcgccagttt
acgccggagtccgtcgcctcgttacaggcagaagtgggcacgctgaccaaactggtggac
gatttacatcagctgtcgctctccgacgagggcgcgctcgcttaccagaaaaaaccgctg
gagatcgtcgcgctcatcgaagtggccgctggcgcgttccgcgagcgcttcgcagcgcgc
gggttgacgctcaacttatcgctgccggaaaacgtcacgctgttcggcgaccgcgaccgg
ctgatgcagctgtttaataatctgctggaaaacagcctgcgctacacggacgcgggcggc
ggtctgttgattcagggcgagtgccagggagcccgctttgtgctgcgctttagcgacagc
gcgccgggcgtgagcgacgagcagctcgcgaaactgtttgagcgcttttaccgcgccgaa
ggctcgcgcaaccgcgccagcggcggttcgggtctcggcctcgccatctgcgccaatatc
gtggcggcgcatggcggtaccattagcgccgatcattcctcatcaggcggtgttagcatt
accgtatccttaccgcttgatgccatccttccgggagacgtatga

DBGET integrated database retrieval system