KEGG   Cronobacter dublinensis: AFK67_14625Help
Entry
AFK67_14625       CDS       T04061                                 

Definition
(GenBank) indolepyruvate decarboxylase
  KO
K04103  indolepyruvate decarboxylase [EC:4.1.1.74]
Organism
cdm  Cronobacter dublinensis
Pathway
cdm00380  Tryptophan metabolism
cdm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    AFK67_14625
Enzymes [BR:cdm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.74  indolepyruvate decarboxylase
     AFK67_14625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_C TPP_enzyme_M
Motif
Other DBs
NCBI-ProteinID: ALB67639
UniProt: A0A0K2P4C3
Position
complement(3182116..3183783)
Genome map
AA seq 555 aa AA seqDB search
MPDHYCIADYLLDRLAGCGVKHLFGVPGDYNLLFLDNVIAHPRITWVGCANELNAAYAAD
GYARCTGIGALLTTYGVGELSALNAIAGSYAEAVPVLHVVGAPCQSAQRKGEVLHHTLGD
GDFHHFMRIAREVTAAQGWLTPANACSEIDRVMAEMLRTRRPGYLVLPTDVASAPATPPV
NAITVPRPQADDAQLAAFREAAQARFARSERVALLADFLAQRFGVQKALHQWLDDTPMPH
SSLLMGKGVLDETRAGFTGTYSGAASSPEVCRAIEEADLVICVGVQFSDTITAGFTQRLT
RDQTLDVQPWATRVGDRWFSGIAMDQAVAILHDIAKRHSARLALPEITPPAATPPVSGAL
NQNNFWTLMAAFVQPGDILAVDQGTAAFGAAALRLPAGCDFLVQPLWGSIGYALPAAFGA
QTACPNRRVVLITGDGAAQLSIQELGSMLRDGQAPVVIVLNNDGYTVERAIHGATQRYND
IAPWQWTQLPHALHADSQAQSWRVSDTAQLREVLERLARPERLSLIEVMLPRDDVPPLLD
AVSRALEARNGAKEE
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgccagaccactactgtattgccgactatctgttggatcgcctggcgggatgtggcgtt
aaacacctgtttggcgtgcccggagattacaatctgctgtttcttgataacgtcatcgcc
cacccgcgcatcacctgggtcggctgcgctaacgagctcaacgccgcctacgccgccgac
ggctacgcgcgctgtaccggtattggcgcgcttctcaccacttacggcgtgggagagctc
agcgcgctcaacgccatcgcgggcagctacgccgaagcggtgccggtgctgcatgtggtc
ggcgcgccctgccagtcggcgcagcgcaagggcgaagtgctgcaccacacgctcggcgac
ggcgattttcaccactttatgcgtatcgccagagaggtcactgccgcccagggctggctc
acgcccgccaatgcctgtagcgaaatcgaccgtgtgatggcggaaatgctgcgcacccgc
cgtcctggttatctggtactgccaaccgatgtggcaagcgcgcctgccaccccgcctgta
aacgctatcaccgtgccgcgcccgcaggcggatgacgcgcagctggccgcctttcgcgaa
gccgcacaggcgcgtttcgcgagaagcgagcgtgtggcgctgctggcggattttctggca
cagcgcttcggtgtgcagaaggcgctgcaccagtggctggacgacacgccgatgccgcac
agttcgctcctgatgggcaagggcgtgctggatgaaaccagggcaggctttaccggcacc
tacagcggagcggcgagctcgcctgaagtctgccgggcgatagaagaggcggatctcgtt
atctgcgtcggcgtgcagttctccgacaccattaccgccggttttacccagcgtctgact
cgcgaccagaccctcgacgtgcagccctgggcgacacgcgtcggcgaccgctggttcagc
ggcatcgcaatggatcaggcggtcgccatcctgcacgacatcgcgaaacgccacagcgcg
cgcctggcattgcccgagataacgccgcctgccgccacgccgcctgtctccggcgcgctc
aaccagaataacttctggacgctgatggcggcgtttgtgcagcctggcgatattctcgcc
gtcgatcaggggacggccgcgttcggcgccgccgcgctgcgactgcccgccgggtgcgat
ttcctggtgcagccgctctggggctcgataggctacgccttgccggcggcgtttggcgcg
cagaccgcctgcccaaaccgccgcgtggtgctgataacgggcgacggcgcggcgcagctc
tcgattcaggagctgggatcgatgctgcgcgacggccaggcgccggtcgtcatcgtgctt
aataatgatggttatacggtcgagcgcgccattcacggcgcgacgcagcgttataacgat
atcgccccgtggcagtggacccagctaccgcacgcgctgcatgccgacagccaggcgcaa
agctggcgggtgagcgatacggcgcagctcagagaggtgctggaacgcctcgccagaccc
gagcggctgtcgctgattgaggtgatgctgccgcgcgatgacgtgccgccgctgcttgac
gcggtcagccgggcgctggaggcgcgcaacggcgcgaaggaggaataa

DBGET integrated database retrieval system