KEGG   Cronobacter dublinensis: AFK67_16360Help
Entry
AFK67_16360       CDS       T04061                                 

Definition
(GenBank) phenolic acid decarboxylase subunit B
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
cdm  Cronobacter dublinensis
Pathway
cdm00130  Ubiquinone and other terpenoid-quinone biosynthesis
cdm00627  Aminobenzoate degradation
cdm01100  Metabolic pathways
cdm01110  Biosynthesis of secondary metabolites
cdm01120  Microbial metabolism in diverse environments
cdm01220  Degradation of aromatic compounds
Module
cdm_M00117  Ubiquinone biosynthesis, prokaryotes, chorismate => ubiquinone
Brite
KEGG Orthology (KO) [BR:cdm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    AFK67_16360
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    AFK67_16360
Enzymes [BR:cdm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     AFK67_16360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-ProteinID: ALB67952
UniProt: A0A0K2P5Y7
Position
complement(3538958..3539542)
Genome map
AA seq 194 aa AA seqDB search
MTGATGAPLGVALLQALKAMPDVETHLVMSKWARTTIELETPYSWQEEVAGLADVVHSPA
DQAAAISSGSFRTDGMVIIPCSMKTLAGIRAGYAEGLVGRAADVVLKEGRKLVLVPRETP
LSTIHLENLLALSRMGVAIVPPMPAWYNHPQSLDDIINHIVARVLDQFGLDARNARRWQG
LGPAKEQADTHLSR
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgacgggcgcgaccggcgcgccgcttggggtcgcgctgttgcaggcgctaaaagcgatg
cccgacgtggaaacccacctggtgatgtcgaaatgggccagaaccacgattgagctggaa
acgccgtactcctggcaggaggaggtggcggggctggccgatgtcgtacacagtccggcg
gatcaggcggcggccatttcctccggatcgtttcgcaccgacggcatggtaattattccc
tgcagcatgaaaacgctggcgggcatccgcgccgggtatgccgaagggctggtgggccgc
gccgccgacgtggtgctgaaagagggccgcaaactggtgctggtgccgcgcgaaacaccg
ctcagcacgatccatctggaaaacctgctggcgctttcgcgcatgggcgtggccatcgtg
ccgcccatgcccgcctggtacaaccatccccagtcgctggacgacatcatcaaccatatc
gtcgcccgcgtgctcgatcagttcgggctcgacgcccgcaacgcccgccgctggcagggg
ctgggccccgcgaaagaacaagctgacacccatttatcacgataa

DBGET integrated database retrieval system