KEGG   Cronobacter dublinensis: AFK67_16840Help
Entry
AFK67_16840       CDS       T04061                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cdm  Cronobacter dublinensis
Pathway
cdm00071  Fatty acid degradation
cdm00280  Valine, leucine and isoleucine degradation
cdm00310  Lysine degradation
cdm00362  Benzoate degradation
cdm00380  Tryptophan metabolism
cdm00620  Pyruvate metabolism
cdm00630  Glyoxylate and dicarboxylate metabolism
cdm00640  Propanoate metabolism
cdm00650  Butanoate metabolism
cdm00900  Terpenoid backbone biosynthesis
cdm01100  Metabolic pathways
cdm01110  Biosynthesis of secondary metabolites
cdm01120  Microbial metabolism in diverse environments
cdm01130  Biosynthesis of antibiotics
cdm01200  Carbon metabolism
cdm01212  Fatty acid metabolism
cdm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cdm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AFK67_16840
   00630 Glyoxylate and dicarboxylate metabolism
    AFK67_16840
   00640 Propanoate metabolism
    AFK67_16840
   00650 Butanoate metabolism
    AFK67_16840
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AFK67_16840
   00072 Synthesis and degradation of ketone bodies
    AFK67_16840
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AFK67_16840
   00310 Lysine degradation
    AFK67_16840
   00380 Tryptophan metabolism
    AFK67_16840
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AFK67_16840
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AFK67_16840
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AFK67_16840
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cdm04147]
    AFK67_16840
Enzymes [BR:cdm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AFK67_16840
Exosome [BR:cdm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AFK67_16840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ALB68045
UniProt: A0A0K2P5I4
Position
complement(3644383..3645564)
Genome map
AA seq 393 aa AA seqDB search
MKDVVIVGAARTPIGCFQGALAGRSAVELGAVVIEALLSRTGLNPQDVDEVILGQVLTAG
AGQNPARQTALNSGLPWSVSAITINDVCGSGLKALHLATQAIQCGEADVVIAGGQENMSR
APHVLTEGRTGAAPQDGHIIDSLVHDGLWDAFNDYHMGVTAENLAREYNISREHQDAWAL
ASQHKARAAIDSGRFRDEIVPVVIEQWEGAPLVVDTDEQPRADTNAEALARLSPAFQHLG
SVTAGNASSINDGAAAVLMMSASKAEELGLPVLARIRAFASVGVDPALMGIAPVYATRRC
LDRAGWRLDDIDLIEANEAFAAQTISVGKLLEWDERRVNVNGGAIALGHPIGASGCRILV
SLVHEMVKRQARKGLATLCIGGGQGVALAIERD
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgtcgtcattgtgggggccgcgcgtacgcccatcggctgttttcagggcgcg
ctggcgggccgctctgcggtggagctcggcgcggtcgtcatcgaggcgctgctctcgcgc
accgggcttaacccgcaggatgtcgatgaggtgatcctgggccaggtgctgacggcgggt
gccgggcagaacccggcgcggcagaccgcgcttaacagcggcctgccgtggtccgtctcg
gcgatcaccattaacgatgtctgcggctccgggttaaaggcgctacatctggcgacgcag
gctatccagtgcggcgaggcggatgtggtgattgcgggtggccaggagaacatgagtcgc
gcgccgcatgtgctgaccgaaggccgcaccggcgcggcgccgcaggatggtcatatcatt
gacagcctggtgcatgacgggctgtgggacgcctttaacgattaccacatgggcgtgacg
gcggaaaacctggcgcgggaatacaacatcagccgtgaacatcaggacgcctgggcgctg
gcttcgcagcataaagcgcgggcggccatcgacagcggccggtttcgtgacgaaattgta
ccggtggtgattgagcagtgggagggcgcgccgctggtagtcgataccgacgagcaacct
cgcgccgacaccaacgccgaagcgcttgcgcgtctgtcacctgcgtttcaacacctcggc
agcgtgacggcgggcaacgcctcgtcaatcaatgatggcgccgcagcggtgctgatgatg
agcgccagcaaggcggaagagcttggactgccggtgctggcgcgcatccgcgccttcgcg
agcgtcggggtcgacccggcgctgatgggcatcgcgccggtctacgccacgcgccgctgt
ctggatcgcgcgggctggcggcttgacgatatcgaccttatcgaagccaacgaggcgttc
gcggcgcaaactatctcggtcggcaagctgcttgagtgggacgagcgcagagtgaacgtc
aacggcggcgcgattgcgctcgggcatccgatcggcgcgtccggctgccgtattctggtt
tcgctggtgcatgagatggtgaaacgtcaggcgcgcaaagggctggcgaccttatgcatc
ggcggcggtcagggcgtggccctggcgatagagcgcgattaa

DBGET integrated database retrieval system