KEGG   Cronobacter dublinensis: AFK67_20420Help
Entry
AFK67_20420       CDS       T04061                                 

Definition
(GenBank) coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
cdm  Cronobacter dublinensis
Pathway
cdm00860  Porphyrin and chlorophyll metabolism
cdm01100  Metabolic pathways
cdm01110  Biosynthesis of secondary metabolites
Module
cdm_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:cdm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AFK67_20420
Enzymes [BR:cdm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     AFK67_20420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C MerR-DNA-bind Tox-REase-2
Motif
Other DBs
NCBI-ProteinID: ALB68720
UniProt: A0A0K2P7G4
Position
complement(4398844..4400217)
Genome map
AA seq 457 aa AA seqDB search
MSEQVIDWDLALIQKYNYSGPRYTSYPTALEFSEDFGEQAFADAVARYPDRPLSLYVHIP
FCHKLCYFCGCNKIVTRQQHKADQYLDVLEQEIIHRAPLFAGRRVSQLHWGGGTPTYLSK
AQISRLMGLLRANFHFNDDAEISIEVDPREIELDVLDHLHAEGFRRLSMGVQDFNKEVQR
LVNREQDEDFIFALIQRAREVGFTSANIDLIYGLPKQTPESFAFTLQRVAELNPDRLSVF
NYAHLPTLFAAQRKIKEADLPSAQQKLDILQQTIQSLTQAGYQFIGMDHFAKPDDELAIA
QRDGVLHRNFQGYTTQGDTDLLGLGVSAISMIGDCYAQNQKELKRYYQAVDEQGNALWRG
LALTCDDCIRRDVIKALICNFRLDFAAIEKAWGLRFNDYFAEDLQLLAPLAKDGLVEVND
GGIRVTAKGRLLIRNVCMCFDVYLRRKARLQQFSRVI
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagcaggtgattgactgggatctggcccttatccagaaatataactattccggg
ccgcgctatacctcgtatcccaccgcgctggagttctctgaggattttggcgagcaggcg
tttgccgacgcggtcgcgcgctatcctgacaggccgctctcgctttacgttcatatccct
ttctgccacaagctgtgctacttctgcggctgcaataaaattgtcacccgtcagcagcat
aaagccgatcagtatctcgacgtactggagcaggagataattcaccgcgcgccgcttttt
gccgggcgtcgcgtcagtcagctgcactggggcggcggtacgccgacctatctgagcaag
gcgcagatcagccgtttgatgggcctactgcgcgcgaatttccactttaacgacgacgct
gaaatctccattgaagtcgacccgcgcgaaattgagctcgacgtgctggaccacctccat
gccgaaggcttccgccgtctcagcatgggcgtgcaggatttcaacaaagaagtgcagcgg
ctggttaaccgcgagcaggatgaagacttcatcttcgcgctcattcagcgcgcgcgcgag
gtcggcttcacgtcagccaatatcgatttaatctacggcctgccaaagcagacgccggaa
agcttcgcctttacgctgcaacgcgtggcggaactcaacccggaccgcctgagcgtcttt
aactacgcgcatctgccgacgctgttcgccgcccagcgcaaaatcaaagaggccgatctg
ccgtcggcgcagcagaagctcgacatccttcagcagaccatccagtcgctgacccaggcg
ggttatcagtttatcggcatggatcacttcgcaaagcccgatgacgagctcgctatcgcc
cagcgcgatggcgtactgcaccgtaacttccagggctacaccacgcagggcgatactgat
ctgctggggttaggcgtgtcggccatcagcatgatcggcgactgctacgcgcagaaccag
aaagagcttaagcgttactatcaggcggtagacgagcagggcaacgcgctgtggcgcggg
cttgcattgacgtgcgacgactgcatccgccgcgacgtcattaaagcgctgatctgtaat
ttccggctcgatttcgccgcgatcgaaaaggcgtggggtttgcgttttaacgactacttc
gcagaagatctgcaactgctggcgccgcttgcgaaagacgggctggtggaggttaacgat
ggcgggattcgtgtcacggcgaaggggcggctgctgatccgcaacgtctgtatgtgcttt
gacgtttatctgcgccgcaaagcgcggctgcaacagttctcacgcgtgatataa

DBGET integrated database retrieval system