KEGG   Castellaniella defragrans: BN940_01506Help
Entry
BN940_01506       CDS       T03058                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cdn  Castellaniella defragrans
Pathway
cdn00071  Fatty acid degradation
cdn00072  Synthesis and degradation of ketone bodies
cdn00280  Valine, leucine and isoleucine degradation
cdn00310  Lysine degradation
cdn00362  Benzoate degradation
cdn00380  Tryptophan metabolism
cdn00620  Pyruvate metabolism
cdn00630  Glyoxylate and dicarboxylate metabolism
cdn00640  Propanoate metabolism
cdn00650  Butanoate metabolism
cdn00900  Terpenoid backbone biosynthesis
cdn01100  Metabolic pathways
cdn01110  Biosynthesis of secondary metabolites
cdn01120  Microbial metabolism in diverse environments
cdn01130  Biosynthesis of antibiotics
cdn01200  Carbon metabolism
cdn01212  Fatty acid metabolism
cdn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cdn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BN940_01506
   00630 Glyoxylate and dicarboxylate metabolism
    BN940_01506
   00640 Propanoate metabolism
    BN940_01506
   00650 Butanoate metabolism
    BN940_01506
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BN940_01506
   00072 Synthesis and degradation of ketone bodies
    BN940_01506
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BN940_01506
   00310 Lysine degradation
    BN940_01506
   00380 Tryptophan metabolism
    BN940_01506
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BN940_01506
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BN940_01506
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BN940_01506
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cdn04147]
    BN940_01506
Enzymes [BR:cdn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BN940_01506
Exosome [BR:cdn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BN940_01506
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt DUF5417 ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: CDM22778
UniProt: W8WSX2
Position
complement(319400..320581)
Genome map
AA seq 393 aa AA seqDB search
MSDSIVIVSAARTPMGGMMGSLSGLAAHELGAIAIKAAVERAGIAGDAVQEVIMGNVLQA
GQGQAPARQAALGAGLPKSVACSTLHKVCGSGLKAVMLAHDIIKAGSAEVVVAGGQESMS
NAPYLLLKGRQGYRYGHSTVYDHMALDGLEDAYQRGTAMGVFAEDCASKYSFTREQQDAF
SLESLRRARQATEDGSFKWEIAPVTVQGRKGDTVIDTDEAPAKAMPEKIPTLKPAFKKDG
TITAANASSISDGASALVVMSAAKAKELGAAPLARIVGHTQFSHDPQWFTTAPVGAIQKL
LDKAGWQAGDVDLYEINEAFAVVTMAAMADLKIPHDRVNIHGGATALGHPIGASGARLLT
TLIGALRKTGGKRGIASLCIGGGEAVALAVEML
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgtccgattccatcgtcatcgtatccgccgcccgcacccccatggggggcatgatgggc
agcctgtccggcctggccgcgcatgaactgggcgccatcgcgatcaaggccgccgtcgag
cgcgcgggcatcgccggcgacgccgtccaggaagtcatcatgggcaacgtcctgcaggcc
ggccagggccaggcacccgcccgccaggccgccctgggcgcgggcctgcccaaaagcgtc
gcgtgcagcaccctgcacaaggtctgcggctcgggcctgaaggccgtgatgctggcccac
gacatcatcaaggccggctcggccgaggtggtggtggccggcggccaggaaagcatgagc
aacgccccctatctgctgctcaagggccgccagggctaccgctacggccattccacggtc
tacgaccacatggccctggacggcctggaagacgcctaccagcgcggcaccgccatgggc
gtgttcgccgaggactgcgcctccaagtacagcttcacgcgcgagcagcaggacgccttc
tccctggaatcgctgcgccgcgcgcgccaggccaccgaggacggcagcttcaagtgggaa
atcgcgccggtcacggtccagggccgcaagggcgacaccgtgatcgacaccgacgaggcc
cccgccaaggccatgccggaaaagatcccgacgctcaagcccgccttcaagaaggacggc
acgatcacggcggccaacgcgtcctcgatctccgacggcgcctcggcgctggtggtgatg
agcgccgccaaggccaaggaactcggcgccgcgcccctggcgcgcatcgtcggccacacc
cagttctcgcacgatccgcagtggttcaccaccgccccggtcggcgcgatccagaagctg
ctggacaaggccggctggcaggccggcgacgtcgatctgtacgagatcaacgaagccttc
gccgtggtgaccatggccgccatggccgacctgaagatcccgcacgaccgggtcaacatc
cacggcggcgccaccgccctgggccatcccatcggcgcctccggcgcgcgcctgctgacc
acgctgatcggcgccctgcgcaagaccggcggcaagcgcggcatcgcctcgctgtgcatc
ggcggcggcgaagccgtggccctggccgtcgaaatgctgtaa

DBGET integrated database retrieval system