KEGG   Castellaniella defragrans: BN940_03026Help
Entry
BN940_03026       CDS       T03058                                 

Definition
(GenBank) 3-polyprenyl-4-hydroxybenzoate carboxy-lyase UbiX
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
cdn  Castellaniella defragrans
Pathway
cdn00130  Ubiquinone and other terpenoid-quinone biosynthesis
cdn00627  Aminobenzoate degradation
cdn01100  Metabolic pathways
cdn01110  Biosynthesis of secondary metabolites
cdn01120  Microbial metabolism in diverse environments
cdn01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cdn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    BN940_03026
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BN940_03026
Enzymes [BR:cdn01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     BN940_03026
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-ProteinID: CDM23080
UniProt: W8X8H4
Position
655416..656024
Genome map
AA seq 202 aa AA seqDB search
MNPPRRLVVGISGATGVRYATRLLEIARAHGGVETHLVMSPSGVLNVRHELGLDRQAVHA
LADHVHSHRDVGAVLASGSFRTAGMVVVPCSMRTLAAVAHGLSDNLITRAADVTLKERRR
LVLMVRETPFNLAHLRNMTAVTEMGGVIFPPLPAFYLRPVTLDELIDHTVCRVLELFDIH
VPGPRWEGLDDPGVPPRSGGAV
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
gtgaatcccccccggcggctggtcgtcggcatcagcggggcgaccggcgtccggtacgcc
acccgcctgctggaaatcgcgcgggcgcacggcggggtggaaacccatctcgtcatgtcg
ccctccggggtgctgaacgtgcgccatgaactcggcctggatcgccaggccgtgcatgcg
ctggccgatcacgtccacagccatcgggacgtgggcgcggtgctggccagcggcagtttc
cgcacggccggcatggtggtggtgccctgttcgatgcgcacgctggcggccgtggcgcat
ggcctgtcggacaacctcatcacccgggcggcggacgtgaccctcaaggaacgccgccgg
ctggtgctgatggtgcgggaaacccccttcaatctcgcgcatctgcgcaacatgacggca
gtgaccgaaatgggcggcgtgatcttcccgccgctgccggcattctatctgcgcccggtt
acactggatgaactgatcgaccataccgtgtgccgcgtgctggagctcttcgacatccat
gtgcccgggccgcgctgggaaggcctcgacgacccgggcgtccccccgcggagcggcggg
gccgtctga

DBGET integrated database retrieval system