KEGG   Castellaniella defragrans: BN940_05201Help
Entry
BN940_05201       CDS       T03058                                 

Definition
(GenBank) Two-component system response regulator OmpR
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
cdn  Castellaniella defragrans
Pathway
cdn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cdn00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BN940_05201
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:cdn02022]
    BN940_05201
Two-component system [BR:cdn02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   BN940_05201
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C FleQ DUF43
Motif
Other DBs
NCBI-ProteinID: CDM23509
UniProt: W8WVC1
Position
complement(1117501..1118268)
Genome map
AA seq 255 aa AA seqDB search
MPISRPCYIFRMNTQTQTLTRKILIVDDDPRLRDLLRRYLSEQGFNVYVAEDAKEMAKLW
QREHFDLLVLDLMLPGEDGLSICRRLRGSHDNTPIIMLTAKAEEIDRIVGLEMGADDYLT
KPFNPRELLARVNAILRRRGTEEHPGAPSQENESVEFGPYVLNLSTRTLTRNGEAVPITT
GEFSVLKVFARHPKVPLSRDKLMELARGREYEAFDRSLDVQISRLRKLIEPNPSKPVFIQ
TVWGLGYVFVPDGGQ
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
gtgcccatttcccgaccctgttacattttccgcatgaacacgcaaacccagaccctcacc
cgcaagatcctcatcgtcgacgacgatcccaggctgcgcgatctgctgcgccgttacctg
tccgagcagggtttcaatgtctacgtcgccgaggacgccaaggaaatggccaagctctgg
caacgcgaacacttcgatctcctggtgctggacctgatgctgcccggcgaggacggcctg
tccatctgccgccgcctgcgcggcagccacgacaacacgcccatcatcatgctgaccgcc
aaggccgaggaaatcgaccgcatcgtcgggctggaaatgggcgccgacgactacctcacc
aagcctttcaacccgcgcgagctgctcgcccgggtcaacgcaatcctgcgccgccgcggc
accgaagaacaccccggcgcccccagccaggaaaacgaatccgtggaattcggcccctac
gtgctgaacctctccacccgcaccctgacgcgcaacggcgaagccgtgcccatcaccacc
ggcgaattctccgtgctcaaggtcttcgcccgccaccccaaggtcccgctgtcgcgcgac
aagctcatggaactggcccggggccgcgaatacgaagccttcgaccgcagcctggacgtg
cagatctcgcgcctgcgcaagctgatcgagcccaacccctccaagccggtcttcatccag
acggtctgggggctgggctacgtgttcgtgcccgacggcggccagtag

DBGET integrated database retrieval system