KEGG   Castellaniella defragrans: BN940_07521Help
Entry
BN940_07521       CDS       T03058                                 

Definition
(GenBank) D-3-phosphoglycerate dehydrogenase
  KO
K12972  glyoxylate/hydroxypyruvate reductase [EC:1.1.1.79 1.1.1.81]
Organism
cdn  Castellaniella defragrans
Pathway
cdn00260  Glycine, serine and threonine metabolism
cdn00620  Pyruvate metabolism
cdn00630  Glyoxylate and dicarboxylate metabolism
cdn01100  Metabolic pathways
cdn01110  Biosynthesis of secondary metabolites
cdn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cdn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BN940_07521
   00630 Glyoxylate and dicarboxylate metabolism
    BN940_07521
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BN940_07521
Enzymes [BR:cdn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.79  glyoxylate reductase (NADP+)
     BN940_07521
    1.1.1.81  hydroxypyruvate reductase
     BN940_07521
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C NAD_binding_2 3HCDH_N NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-ProteinID: CDM23970
UniProt: W8X902
Position
1591885..1592817
Genome map
AA seq 310 aa AA seqDB search
MEIVFASQLEADPQAWVAALRTALPDARVRLWGDGEPEGRADFAVVWAPPADLFAREPRL
RALFNLGAGVDALLRLPGLPDDLPLVRLEDGGMAVQMAEYALYHLLRESRDFGRYERQQA
EGLWQPLADIDRDAWTVGVLGAGAMGARVAQACAALEYPTAVWSRSGRTVPGVEAYGGEA
DLAAFLARTRVLVNALPLTDATRGILCRRTFEQLRPDAVVINIARGGHLVEADLLAALDG
GRLRSAALDVFEREPLPPGHPFWSHARIRVTPHVAGASLMDGTVRQIAGKIRALDRGEPV
TGVVDRSRQY
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggagatcgttttcgcctcgcaactggaagccgatccgcaggcctgggtagcggccctg
cgcaccgcgctgcccgacgcccgggtgcgcctgtggggcgacggcgagccggaaggccgc
gccgatttcgccgtggtgtgggcgccgccggccgacctgttcgcccgcgagccgcgcctg
cgcgccctgttcaacctgggcgccggggtcgacgccctgctgcgcctgccgggcctgccc
gacgatctgcccctggtgcggctggaagacggcggcatggcggtgcagatggcggaatac
gcgctctaccatctgctgcgcgaatcgcgcgacttcggccgctacgagcgccagcaggcc
gaagggctctggcagcccctggccgacatcgaccgcgatgcctggaccgtcggcgtcctg
ggcgccggcgccatgggcgcgcgggtcgcccaggcctgcgcggccctggaatacccgacg
gcggtctggtcgcgcagcggccgcaccgtgccgggcgtcgaggcctacggcggcgaggcg
gacctggccgcgttcctggcgcgcacgcgcgtgctggtgaacgcgctgccgctgaccgac
gccacacggggcatcctgtgccgccgcaccttcgagcagctgcggcccgacgccgtggtg
atcaacatcgcccggggcgggcatctggtcgaggccgacctgctggccgccctggacggc
gggcgcctgcggtcggcggccctggacgtcttcgagcgcgagcccctgccgcccggccat
cctttctggtcccacgcgcgcatccgggtcacgccgcacgtcgccggcgccagcctgatg
gacgggacggtgcgccagatcgccggcaagatccgcgccctggaccggggcgagccggtc
accggcgtcgtggaccgcagccggcagtattga

DBGET integrated database retrieval system