KEGG   Castellaniella defragrans: BN940_11481Help
Entry
BN940_11481       CDS       T03058                                 

Definition
(GenBank) Superoxide dismutase [Fe]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cdn  Castellaniella defragrans
Brite
Enzymes [BR:cdn01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BN940_11481
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: CDM24755
UniProt: W8X9F9
Position
complement(2490599..2491207)
Genome map
AA seq 202 aa AA seqDB search
MQHLFEGTVMAFTLPPLPYAMDALAPHISQETLEYHYGKHHQAYVTNLNKAIEGTELASL
SLEEVIRKSSGGVFNNAAQVWNHTFYWSSLSPKGGGEPAGALRQAIEAKWGSVDAFKTAF
TQSAAGNFGSGWTWLVKKPDGSLDIVNTSNAGTTVNTDDKALLTCDVWEHAYYIDYRNAR
PKYLENFWNLVNWDFAAANLAS
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgcaacatctttttgaaggaactgtcatggctttcaccctgccgccgctgccctacgcg
atggacgcactggccccccacatttcccaggaaaccctggaataccactacggcaagcat
catcaggcctacgtgacgaacctgaacaaggcgatcgaaggcaccgagctggcctccctg
agcctggaagaggtgatccgcaagtccagcggcggcgtgttcaacaacgccgcccaggtc
tggaaccacaccttctactggagcagcctgtcgcccaagggcggcggcgagcccgccggc
gcgctgcgccaggccatcgaggccaagtggggcagcgtcgatgccttcaagaccgccttc
acccagtccgccgccggcaacttcggttccggctggacctggctggtgaagaagcccgac
ggcagcctggacatcgtcaacaccagcaacgccggcaccaccgtcaacaccgacgacaag
gccctgctgacctgtgacgtgtgggaacacgcctactacatcgactaccgcaacgcccgt
cccaagtacctggaaaacttctggaacctggtgaactgggacttcgcggcggccaacctg
gcttcctga

DBGET integrated database retrieval system