KEGG   Castellaniella defragrans: BN940_12666Help
Entry
BN940_12666       CDS       T03058                                 

Definition
(GenBank) Histidine ABC transporter, permease protein HisQ
  KO
K10016  histidine transport system permease protein
Organism
cdn  Castellaniella defragrans
Pathway
cdn02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:cdn00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BN940_12666
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cdn02000]
    BN940_12666
Transporters [BR:cdn02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    BN940_12666
   Histidine transporter
    BN940_12666
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: CDM24984
UniProt: W8WZE6
Position
2731048..2731737
Genome map
AA seq 229 aa AA seqDB search
MFLDGYGPLLLEGTWVTIKLALLSLAVAVGLGLLGAWAKLSASWGARLAATAYTTLIRGV
PDLVLMLLIFFSMQIYLNDLTDLLGLDPIDIDPFGAGVLTLGFIYGAYFAETFRGAFMAV
PYGQMEAATAYGMREFQVFRRVLFPQMMRHALPGIGNNWQVLLKSTALVSLIGLTDLVKV
AQDAGNVTFRVFLFISLTGLIYLALTTLSNGILYWLDRRYSVGVREAQL
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgtttctagacggctacggtcccctgctgctggaggggacgtgggtcaccatcaagctc
gcgctgctgtccctggccgtggccgtggggctggggctgctgggcgcctgggccaagctg
tcggcctcgtggggcgcccgcctggccgccaccgcctacaccacgctcatccgcggcgtc
ccggatctggtgctgatgctgctgatcttcttcagcatgcagatctacctgaacgacctg
accgacctgctcgggctggacccgatcgacatcgatcccttcggcgccggcgtgctgacg
ctgggcttcatctacggcgcctacttcgccgagaccttccgcggcgcgttcatggccgtg
ccctacggccagatggaggccgccacggcctacggcatgcgcgaattccaggtcttccgc
cgcgtgctgttcccgcagatgatgcgccacgccctgcccggcatcggcaacaactggcag
gtcctgctgaaatccaccgcgctggtgtcgctgatcggcctgaccgacctggtcaaggtc
gcccaggacgcgggcaacgtcaccttccgggtgttcctgttcatcagcctgaccggcctg
atctacctggccctgaccaccctgtccaacggcatcctgtactggctggaccgccgctac
agcgtgggcgtgcgcgaggcgcagctatga

DBGET integrated database retrieval system