KEGG   Castellaniella defragrans: BN940_17096Help
Entry
BN940_17096       CDS       T03058                                 

Definition
(GenBank) class II aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
cdn  Castellaniella defragrans
Pathway
cdn00051  Fructose and mannose metabolism
cdn01100  Metabolic pathways
cdn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cdn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BN940_17096
Enzymes [BR:cdn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     BN940_17096
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: CDM25852
UniProt: W8X5R3
Position
complement(3704885..3705652)
Genome map
AA seq 255 aa AA seqDB search
MTAVLREKSYFDQRATQEMREHLHPVQRTLQEDLAYACRILAATGQEAGLAGQISARSDT
PGAYWTLRFGLGFDEATPNDFIEVGADLETLSGQGMANPATRFHLWIYKSRPDVNAIIHT
HSPWVSALVAARQPLVVAQMDMTPFHNDCAFLADWPGVPIADQEGVLISEALGGKRSIIL
AHHGYLTTGGTMAEATYLSVYLERAARMQTRARVYGELTPVPDHLAQEAHDYLLKPSIVK
GTFDYWCRQIDRSAA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgacggcagtgcttagggaaaaatcgtattttgatcaacgcgctacacaagaaatgcgc
gaacatcttcaccccgttcagcgaaccctccaggaagacttggcctatgcctgtcggatc
ctggccgcaaccggccaggaggccgggctggctgggcagatcagtgcgcgctccgacacc
ccgggggcctactggactttgcgcttcgggttagggtttgacgaggccacgcccaatgac
tttatcgaggtcggcgctgacctggaaaccctgtcggggcagggcatggccaatccggcg
acccgctttcacctatggatctacaagagccggccggatgtcaatgccatcatccatacg
cattctccgtgggtcagcgcgctggtggccgcacgccagcccctggtggtggcgcaaatg
gacatgacgccttttcacaatgactgcgcgtttttggctgactggcccggggtgcccatc
gccgaccaggagggcgtgctgatttccgaggcgctcggcggcaagcgttccatcatcctg
gcgcatcatggctatctgacgacgggcggcaccatggccgaagccacctacctgtcggtc
tacctggagcgcgcggcccgcatgcagacccgtgcccgcgtctacggtgagctgaccccc
gtgccggaccatctggcgcaggaggctcacgactatctgctcaagccttcgatcgtcaag
ggcacgttcgactactggtgccgccagatcgaccggtccgccgcctga

DBGET integrated database retrieval system