KEGG   Corynebacterium doosanense: CDOO_00185Help
Entry
CDOO_00185        CDS       T03413                                 

Definition
(GenBank) methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
cdo  Corynebacterium doosanense
Pathway
cdo00670  One carbon pool by folate
cdo01100  Metabolic pathways
cdo01120  Microbial metabolism in diverse environments
cdo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cdo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    CDOO_00185
Enzymes [BR:cdo01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     CDOO_00185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: AIT59917
UniProt: A0A097ICR0
Position
36428..37417
Genome map
AA seq 329 aa AA seqDB search
MSVSSQAAPRLSASAPVDTQEQTDTPHPTWDRLALSFEVIPPRINQAGDRDKLDALLAEV
QTYRPDYVAVTSSARSGWLDGTAAVIEYITDNSRLRPLAHLACTAGTEEEVVRGINQLVD
AGVRGLLALRGDLPAGEQSLPSGYLQHATDLIRVIRAVEKRQAARFAAGSLAVGVACYPS
GHAEAANEDEDYDVLLAKQRLGADFAITQLFFDADDYLRFAEKARLAGVTIPLIPGIMPM
TSAARLERMGKLAGLSVPEHLRRQMAEAAENGPLAEREAGLALTAQLTRDILAGGAGGLH
VYTHNDMDVTRDLLDQVGVTPAAPHPRRA
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtcagctcgcaggctgctccgcgtctatccgcctccgcaccggtggacacccag
gagcagaccgacaccccccaccccacctgggaccgcctcgcgctctccttcgaggtcatc
ccgccgcgcatcaaccaggccggcgaccgtgacaaactcgacgcgctgctcgccgaggtg
cagacctaccgccccgactacgtcgccgtcacctcctccgcccgctccgggtggctggac
ggcacggccgccgtcatcgagtacatcaccgacaactcccgcctgcgcccgctggcgcac
ctcgcctgcaccgcgggcaccgaggaggaggtcgtgcgcggcatcaaccagctggtcgac
gccggcgtgcgcggcctgctggcgctgcgcggtgacctcccggccggggagcaatcgctg
cccagtggctacctgcagcacgccacggacctcatccgggtgatccgcgccgtcgagaag
cgacaggcggcgcggttcgccgccggatctctcgccgtgggcgtggcctgttacccctcc
ggccacgccgaggcagccaacgaggacgaggactacgacgtcctgctggccaagcagcgc
ctcggggcggacttcgccatcacccagctcttcttcgacgccgacgactacctgcgtttc
gccgagaaggcacgcctggccggcgtcaccatcccgctcattccgggcatcatgcccatg
acttcggccgccaggctggaacgcatgggcaagctggccgggttgagcgtgcccgagcac
ctccgccgccagatggcggaggccgccgagaacggacccctcgccgagcgagaggccgga
ctggcgctcaccgcccagctgaccagggacatcctggccggcggtgcgggcgggctgcac
gtgtacacgcacaacgacatggacgtcacccgcgacctgctcgaccaggtcggggtcacg
cccgccgcgccacacccccgcagagcctga

DBGET integrated database retrieval system