KEGG   Corynebacterium doosanense: CDOO_05390Help
Entry
CDOO_05390        CDS       T03413                                 

Definition
(GenBank) segregation protein B
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
cdo  Corynebacterium doosanense
Pathway
cdo00450  Selenocompound metabolism
cdo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CDOO_05390
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cdo03016]
    CDOO_05390
Enzymes [BR:cdo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     CDOO_05390
Transfer RNA biogenesis [BR:cdo03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    CDOO_05390
 Prokaryotic Type
    CDOO_05390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS AIRS_C
Motif
Other DBs
NCBI-ProteinID: AIT60749
UniProt: A0A097IF51
Position
complement(1052956..1053951)
Genome map
AA seq 331 aa AA seqDB search
MSELLDRYKMTSYAHGGGCACKIPPGELEEAVRGLVGHADPNVIVGLDDGDDASAVRIAD
GLAVISTADFFTPVVNNAYDWGRIAAANALSDVYAMGGRPVTAINLLGWPREVLPTELMS
EVLRGGLDVATQAGISVTGGHSIDSPEPTYGMAVTGVAHPDRLMRNDAAAAGLPITLTKP
IGVGILNNRHKSTGEDFPEAVEQMVALNREASEAALAAGVRAATDVTGFGLLGHLYKMMR
ASGVSAVLDSSAVPALEAAVSSIAEGFVSGGSQRNLAWVRPHLVAEGVAEETLILLADAQ
TSGGLLVVGEVPGYPVIGETVAGEPGTVTVR
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaactgttggaccggtacaagatgacctcgtacgcgcacggcggcggctgcgcc
tgcaagatcccgccgggcgagctggaggaggccgtgcgcggcctggtcgggcacgcggac
cccaatgtcatcgtcgggcttgacgacggcgacgacgcctcggccgtgcgcatcgccgac
ggcctggccgtcatctccacggcggacttcttcacacccgtggtcaacaacgcctacgac
tggggccgcatcgccgcggccaacgcgctgagcgacgtctacgccatgggcgggcgcccc
gtcaccgccatcaacctgctcggctggccccgcgaggtgctgcccaccgagctcatgagt
gaggtgctgcgtggcgggctggacgtggccacccaggcgggcatctccgtcaccggcggg
cattccatcgactcccccgagccgacctacggtatggccgtcaccggcgtggcacatccg
gacaggctcatgcgtaacgacgccgccgcagccgggctgcccatcaccctcaccaagccc
atcggcgtgggcatcctcaacaaccggcataagtccaccggggaggactttcccgaggcg
gtggagcagatggtcgcactcaaccgggaggcctccgaggcggcgctggccgcgggtgtc
cgggcagcgacggatgtcaccggcttcgggctgctcggccacctgtacaagatgatgcgt
gcctccggggtgtcggccgtgctcgactcttccgccgtgccggccctcgaggccgcggtg
tcctccatcgccgaggggtttgtctccggaggttcccagcgcaacctcgcatgggtgcgc
cctcacctggtcgccgagggcgtcgccgaggagacactcatcctgctcgcggacgcgcag
acctccggcggcctgctggtggtcggcgaggtgccggggtaccccgtgatcggcgagacg
gtggcgggcgaaccggggacggtgacggtgcgctaa

DBGET integrated database retrieval system