KEGG   Corynebacterium doosanense: CDOO_07595Help
Entry
CDOO_07595        CDS       T03413                                 

Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
cdo  Corynebacterium doosanense
Pathway
cdo00030  Pentose phosphate pathway
cdo00480  Glutathione metabolism
cdo01100  Metabolic pathways
cdo01110  Biosynthesis of secondary metabolites
cdo01120  Microbial metabolism in diverse environments
cdo01130  Biosynthesis of antibiotics
cdo01200  Carbon metabolism
Module
cdo_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
cdo_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:cdo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CDOO_07595
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CDOO_07595
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cdo04147]
    CDOO_07595
Enzymes [BR:cdo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     CDOO_07595
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     CDOO_07595
Exosome [BR:cdo04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   CDOO_07595
  Exosomal proteins of colorectal cancer cells
   CDOO_07595
  Exosomal proteins of bladder cancer cells
   CDOO_07595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AIT61135
UniProt: A0A097IG70
Position
1506020..1507558
Genome map
AA seq 512 aa AA seqDB search
MPTRRIAWTNPLRNPLDKRLPRIAGPAGMVLFGVTGDLARKKILPAIYDLANRGLLPAGF
TLVGFGRREWSKEDFQDYVRKAVEERARTTWNEHVWERLAEGLNFVTGNFDDDAAFDAMA
QTLSELDATRGTGGNWAFYLSIPPESFADVCHQLDRTGMAEAKGESWRRVVIEKPFGHDQ
ESARELNAIVNAVFPEDDVFRIDHYLGKETVQNILALRFANQLFDPMLNSHYVDHVQITM
AEDIGLGGRAGYYDGIGAARDVIQNHLLQLLALVAMDEPFSFSPRDMQDEKVKVLRAVKP
VEPFELTTARGQYTAGWQGSEKVVGLREEEGFDAESRTETYAACTVEITSRRWAGVPFYL
RTGKRLGRRVTEIAIVYKDAPHQPFTRGEIGSLGQNAMVIRVQPDEGMLMRFGSKVPGST
MEVRDVNMDFSYAEAFTEQSPEAYERLILDALLDEASLFPTNEEVELSWEILDPILAHWA
ENGRPDEYPAGSWGPPSADAMLARDGRTWRRP
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgccgactcgccgcatcgcctggacaaaccccctgcgcaatcctctggacaaacgactc
ccgcgcatcgccggacccgcaggaatggtgctcttcggggtgacgggtgacctcgcccgc
aagaagatcctcccggccatctacgacctggccaaccgcggcctgctgccggccggattc
acgctggtggggttcgggcgccgggaatggtccaaggaggatttccaggactacgtgcgt
aaggccgtcgaggagcgggcccggaccacgtggaacgagcacgtctgggagcgcctcgcc
gagggcctcaacttcgtcaccggcaacttcgacgacgacgccgccttcgacgccatggcg
cagacgctcagcgagctggacgctacgcgcggcaccggcggcaactgggcgttctacctg
tccatccccccggagagtttcgccgatgtctgccaccagctcgaccgcaccggcatggcc
gaggcgaagggtgagagctggaggcgcgtggtgattgagaagccgttcggccacgaccag
gagtccgcccgcgagctcaatgccatcgtcaacgcggtcttcccggaggacgatgtgttc
cgcatcgaccactacttgggcaaggagacggtgcagaacatcctcgcgttgcgtttcgcc
aaccagctcttcgacccgatgctcaactcgcactacgtcgaccacgtgcagatcaccatg
gccgaggacatcggcctgggcggtcgtgccggctactacgacggcatcggcgccgcccgc
gacgtcatccagaaccacctgctgcagctgctggcgctcgtggccatggacgagccgttc
tccttctcccccagggacatgcaggacgagaaggtcaaggtgctgcgggcggtcaaaccc
gtggagcccttcgagctcaccaccgcgcgcgggcagtacaccgccggctggcagggttcg
gagaaggtcgtcggcctgcgcgaggaggagggtttcgacgcggagtcacgcaccgagacc
tacgccgcgtgcacggtggagatcacctcccgtcgctgggcgggcgtgcccttctacctg
cgcacgggcaagcgactgggccgccgggtgacggagatcgccatcgtgtacaaggacgcc
ccgcaccagccgttcacccgcggggagatcggctcgctgggtcagaacgccatggtcatc
cgcgtccagcccgacgagggcatgctcatgcgtttcggctccaaggtgccgggctcgacc
atggaggtccgcgacgtcaacatggacttctcctacgcggaggccttcaccgagcagtct
cccgaggcctacgagcggctcatcctcgatgcgcttctcgacgaagcgagcctcttcccc
accaacgaggaggtggagctcagctgggagatcctcgatcccatcctagcgcactgggcg
gagaacggccgccccgacgagtacccggccggatcgtggggcccgccgagcgccgacgcc
atgctcgcccgcgacggccgcacctggcggcgtccctaa

DBGET integrated database retrieval system