KEGG   Corynebacterium doosanense: CDOO_09020Help
Entry
CDOO_09020        CDS       T03413                                 

Definition
(GenBank) acyl-CoA oxidase
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
cdo  Corynebacterium doosanense
Pathway
cdo00071  Fatty acid degradation
cdo00410  beta-Alanine metabolism
cdo00592  alpha-Linolenic acid metabolism
cdo00640  Propanoate metabolism
cdo01040  Biosynthesis of unsaturated fatty acids
cdo01100  Metabolic pathways
cdo01110  Biosynthesis of secondary metabolites
cdo01200  Carbon metabolism
cdo01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cdo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CDOO_09020
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CDOO_09020
   00592 alpha-Linolenic acid metabolism
    CDOO_09020
   01040 Biosynthesis of unsaturated fatty acids
    CDOO_09020
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CDOO_09020
Enzymes [BR:cdo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     CDOO_09020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACOX Acyl-CoA_dh_N Acyl-CoA_dh_M Acyl-CoA_dh_1 TetR_N
Motif
Other DBs
NCBI-ProteinID: AIT61387
UniProt: A0A097IH15
Position
complement(1794598..1797201)
Genome map
AA seq 867 aa AA seqDB search
MKSKETADGRSTRWAEHRRNKKRELSSAALRAIRQRGPQVGMGEIAEVAGTSKTVYYRHF
SDRAGLWSAVVERSVDFIYDELPLSRIDRLTVPELIAELADSYLTLVEKDPEIYEFVTTR
PGTPSPAEYTDPEITLTARIAGKLAETLDLQGMGERSEIWAHAIVGATWAIANRWMITGR
TKPKDEVVAQIRDLFAPGLSLHHHPPIDLSKEHPMTTTTPVATTNPVVGNSDNLSPLGRD
LRKALDGKHHELKQTLRDNMTADMIVRPFDQSVDEARDWVLESIGKLIEHGFSKVGMPAE
YGGTHSLSESIAAFEILAMGDLSLTIKSGVQQGLFGGAVLNLGDDAQKKEWLSKIISAEL
LGCYGMTELGRGSDVQHLETTITYIPETDEFEIHTPDDDARKAYIGNAARDGQKAAVFGQ
LIVNGENHGVHCVIADVRDENGDPAPGVTIGDHGRKGGLLGVDNGTLAFDHVRVPRFNLL
NRYGKVDENGVYTSPIERRGQRFSTMLSTLVRGRISVGGAGGSATRRGLTIAVKHALART
QFTDTTGKPVTIMNYQTHQAKLVPEVARAYAFGFAQNELIDHFQQVQDGAEEKVVRELEG
HAAGMKAVQTRWANDTLQVCREACGGYGYMAENGLTTLTADADVFATFEGDNTVLLMLTG
RGLLAGFKSSWAELDMLDTARKSAALVGTRIIERTTARPTIERLVSIANRKSGADILRAR
GWHVEMLEYREKRMVESLGLRMREVLKVEKEKEFDAFNSCQNHMIAASLAHMDRIILEAF
VEGISNTPEGEARDTLIKLCDLYALATIAEHRAWFLEHGAIDGGRSREITQAVERISAEL
TENIEPIVEGLGVPEAWLNSKIAAEGK
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcgaaggagaccgcggacggcaggtcgacccgctgggccgagcaccgtcggaac
aagaagagagagctctcttctgcggcgctccgggcgatccggcaacgcggaccgcaggtg
ggcatgggagaaattgcggaggtggctggaacctcaaaaacagtctactaccgccacttt
tccgatcgtgccggtttgtggtccgcagtggtggaacgttccgtcgacttcatctacgac
gagttgccactcagccggattgatcggctgaccgtgccggagctcatcgctgaactggcg
gactcctacctgaccctggttgaaaaggatccggaaatatacgagttcgtcaccacccgc
cccggcaccccctctccggcggagtacacggatcccgagatcacgctgacagcgcgcatc
gcgggaaagctcgccgaaaccctggacctgcagggtatgggcgagcggtcggaaatctgg
gcccatgccatagtcggcgccacctgggccatcgccaaccggtggatgatcaccggccgg
acgaaacccaaggacgaagtcgtcgcccagatccgcgacctgttcgcccctggactctcc
ctgcatcatcaccctcccattgacctttccaaggagcacccgatgaccaccactacacct
gtggcaaccaccaaccccgtcgtgggcaacagcgacaacctctcgccgctcggccgcgac
ctgcgcaaggctctcgacggcaagcaccacgagctcaagcagacgctgcgcgacaacatg
accgccgacatgatcgtgcgcccgttcgaccagagcgtcgacgaggctcgcgactgggtt
cttgagtcgatcggcaagctcatcgagcacggtttcagcaaggtgggcatgcccgccgag
tacggcggcacccactcgctgtccgagtccatcgcggccttcgagatcctcgccatgggc
gatctctccctcaccatcaagagcggtgtccagcagggcctgttcggcggcgccgtgctc
aacctcggtgacgacgcgcagaagaaagagtggctgagcaagatcatcagcgccgagctt
ctcggctgctacggcatgaccgagctcggccgtggttccgacgtccagcacctcgagacc
accatcacctacatcccggagaccgacgagttcgagatccacaccccggacgacgacgcc
cgcaaggcctacatcggcaacgcggcacgcgacggccagaaggccgccgtcttcggccag
ctcatcgtcaacggtgagaaccacggcgtgcactgtgtcatcgccgacgtccgcgacgag
aacggcgacccggctccgggtgtcaccatcggtgaccacggccgcaagggtggcctgctc
ggtgtcgacaacggcacccttgccttcgaccacgtgcgtgttccccgcttcaacctgctc
aaccgctacggcaaggtcgacgagaacggcgtctacacctcgcccatcgagcgtcgtgga
cagcgcttctccaccatgctcagcaccctcgtgcgtggccgcatctccgtcggtggcgcc
ggcggatccgccacccgccgcggcctgaccatcgccgtcaagcacgcactggctcgtacc
cagttcacggacaccacgggcaagccggtcaccatcatgaactaccagacccaccaggcg
aagctggtccccgaggttgcccgcgcctacgccttcggcttcgcgcagaacgagctcatc
gaccacttccagcaggtccaggacggcgccgaagagaaggtcgtgcgcgagctcgagggc
cacgctgccggcatgaaggccgtgcagacgcgctgggccaacgacaccctccaggtgtgt
cgcgaggcttgcggcggctacggctacatggccgagaacggcctgaccacgctgaccgcc
gacgcggacgtcttcgccaccttcgagggcgacaacaccgttctgctcatgctcaccggc
cgtggcctgctcgcgggcttcaagtccagctgggccgagcttgacatgctcgacaccgcc
cgcaagagcgcggccctggtgggcacccgcatcatcgagcgcaccacggcgcgcccgacc
atcgagcgtctcgtgtccatcgccaaccgcaagtccggcgcggacatcctgcgcgcccgc
ggctggcacgtggagatgctcgagtaccgcgagaagcgcatggtcgagtccctcggcctg
cgcatgcgcgaggtgctcaaggtggagaaggagaaggagttcgacgccttcaactcctgc
cagaaccacatgatcgcggcctcgctcgcgcacatggaccgcatcatcctcgaggccttc
gtcgagggcatcagcaacacgcccgagggtgaggctcgcgacaccctcatcaagctgtgt
gacctctacgccctggcgaccatcgcggagcaccgcgcatggttcctcgagcatggcgcc
atcgacggtggccgctcgcgggagatcacccaggccgtggagcggatctccgccgagctc
accgagaacatcgagccgatcgtcgagggcctcggtgtccccgaggcatggctgaactcg
aagatcgccgccgaagggaagtaa

DBGET integrated database retrieval system