KEGG   Corynebacterium doosanense: CDOO_09025Help
Entry
CDOO_09025        CDS       T03413                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cdo  Corynebacterium doosanense
Pathway
cdo00071  Fatty acid degradation
cdo00072  Synthesis and degradation of ketone bodies
cdo00280  Valine, leucine and isoleucine degradation
cdo00310  Lysine degradation
cdo00362  Benzoate degradation
cdo00380  Tryptophan metabolism
cdo00620  Pyruvate metabolism
cdo00630  Glyoxylate and dicarboxylate metabolism
cdo00640  Propanoate metabolism
cdo00650  Butanoate metabolism
cdo00900  Terpenoid backbone biosynthesis
cdo01100  Metabolic pathways
cdo01110  Biosynthesis of secondary metabolites
cdo01120  Microbial metabolism in diverse environments
cdo01130  Biosynthesis of antibiotics
cdo01200  Carbon metabolism
cdo01212  Fatty acid metabolism
cdo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cdo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CDOO_09025
   00630 Glyoxylate and dicarboxylate metabolism
    CDOO_09025
   00640 Propanoate metabolism
    CDOO_09025
   00650 Butanoate metabolism
    CDOO_09025
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CDOO_09025
   00072 Synthesis and degradation of ketone bodies
    CDOO_09025
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CDOO_09025
   00310 Lysine degradation
    CDOO_09025
   00380 Tryptophan metabolism
    CDOO_09025
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CDOO_09025
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CDOO_09025
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CDOO_09025
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cdo04147]
    CDOO_09025
Enzymes [BR:cdo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CDOO_09025
Exosome [BR:cdo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CDOO_09025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AIT61388
UniProt: A0A097IGU9
Position
1797276..1798523
Genome map
AA seq 415 aa AA seqDB search
MSNDLRNAVVVGGNRTPFARTGTAYADVSTQELLTAALNGLVARFALTGEKIDEVAAGAV
LKHARDFNLTRECVLSSGLDPHTPAVDLQQACATSLETFVYSANKIRLGQANTAIAGGVD
SASDAPIAVSEGLRKALLRASREKTTQGRLKAFAAIRPKDLQPAPPSVEEPRTHKSMGES
QAETGKAYGISREAQDELAYQSHQNLAKAWDEGFFDDLVTSFNGLTKDNVLRPDTTVEKL
AKLRPAFGDTMTAGNSTNMTDGAAVVLLADEETARARNWEPLAKFVDAQVAAVNHVDGPE
LTDGLLLAPTRAIPEILERNGLTADDIDLYEIHEAFASTVLATLANLDEQGINIPRDRIN
KDGSSLAAGHPFAATGARIIASLSKRLHERGAGSRGLISVCAAGGQGVVVILEAM
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgtctaacgatctgagaaatgccgtcgtcgtcggcggcaaccgaacccccttcgcccgc
accggcaccgcctacgcagacgtctccacccaggaactcctgaccgcagccctcaacggc
ctcgtcgcccgcttcgccctcaccggcgagaagatcgacgaggtcgctgccggcgccgtg
ctcaagcacgcgcgtgacttcaacctcacccgcgagtgcgtgctcagctcgggcctcgat
ccccacacccccgccgtcgatctccagcaggcctgcgccaccagcctcgagaccttcgtc
tactcggccaacaagatccgcctcggtcaggccaacaccgcgatcgccggcggtgtcgac
tccgcgtccgacgcccccatcgccgtctccgagggcctgcgcaaggccctgctgcgcgcc
agccgcgagaagaccacccagggtcgcctcaaggcgttcgccgcaatccgccccaaggat
ctgcagcccgctcccccctccgtggaggagccccgcacccacaagagcatgggcgagtcc
caggcagagaccggcaaggcctacggcatctcccgcgaggcccaggacgagctggcctac
cagagccaccagaacctggccaaggcctgggacgaaggtttcttcgatgacctggtcacc
tccttcaacggtctgaccaaggacaacgtccttcgcccggacacgaccgtcgagaagctg
gccaagctgcgcccggccttcggcgacaccatgaccgccggcaactccaccaacatgacc
gacggcgcagccgtggtcctgctggccgacgaggagaccgcccgcgcccgtaactgggag
ccgctggccaagttcgtcgacgcccaggttgccgccgtcaaccacgtcgacggccccgag
ctcaccgacggtctgctgctggccccgacccgcgccatcccggagatcctcgagcgcaac
ggcctgaccgccgacgacatcgatctctacgagatccacgaggcattcgcctccaccgtg
ctcgccaccctcgctaaccttgacgagcaggggatcaacattccccgcgaccgcatcaac
aaagacggctcctccctggcagccggccaccccttcgccgctacgggcgcccgcatcatc
gcgagcctgtccaagcgactgcacgagcgtggcgccggctcccgcggactcatctcggtc
tgcgccgctggtggccagggcgtcgtcgtgattctggaggcaatgtaa

DBGET integrated database retrieval system