KEGG   Corynebacterium diphtheriae 241: CD241_0835Help
Entry
CD241_0835        CDS       T01687                                 

Gene name
uppS1
Definition
(GenBank) undecaprenyl pyrophosphate synthetase
  KO
K12503  short-chain Z-isoprenyl diphosphate synthase [EC:2.5.1.68]
Organism
cdp  Corynebacterium diphtheriae 241
Pathway
cdp00900  Terpenoid backbone biosynthesis
cdp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cdp00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CD241_0835 (uppS1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:cdp01006]
    CD241_0835 (uppS1)
Enzymes [BR:cdp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.68  (2Z,6E)-farnesyl diphosphate synthase
     CD241_0835 (uppS1)
Prenyltransferases [BR:cdp01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   CD241_0835 (uppS1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Prenyltransf
Motif
Other DBs
NCBI-ProteinID: AEX43902
Position
848610..849407
Genome map
AA seq 265 aa AA seqDB search
MRTLKKFSLRDLAYNAAYPFYEKRLMREIQGVRQPEHVAIMCDGNRRWAREAGFADVTHG
HRVGAKKIGEMVRWCAHTDVELVTVYLLSTENLGRASDELQMLFDIIGDVVDELASPETN
CRLRLVGHLDLLPDDVSRRLTQAQDSTNDNTGVFVNVAVGYGGRQEIVDAVRELIDAEAA
AGTTATEMAEKISVDSISKHLYTSGQPDPDLVIRTSGEQRLSGFLLWQAAYSEIWFTDTY
WPAFRRVDFLRALREYSKRSRRFGK
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgcgcacactaaaaaagttctctctccgcgaccttgcttataacgctgcatatcctttc
tatgagaagcgactgatgcgagaaattcaaggggtgcggcagcctgagcacgttgccatc
atgtgtgatggcaatcgccggtgggctcgtgaggccggatttgccgatgttacccatggg
catcgcgtaggtgctaagaaaattggcgaaatggtgcggtggtgtgcgcatactgatgtt
gaactcgtaaccgtctacctgctatcgacggaaaacctaggtcgagcctccgatgaacta
caaatgttgttcgacatcattggcgacgtcgtagatgagctcgcctccccagaaaccaat
tgtcgtctgcggcttgtcggacaccttgatttactgcctgacgacgtctcccggcgtctc
acccaagcccaagacagcaccaacgacaacaccggagtcttcgtcaacgttgccgttggc
tatggcggccgccaagaaatcgtcgatgcggtgcgcgagcttatcgacgccgaagctgca
gcaggaacaacagctacagaaatggccgagaaaatctccgtcgattccatttccaagcat
ctgtatacatcgggtcaaccagacccagatctcgtgattcgtacctcaggcgaacaacgc
ctctctggctttttgttgtggcaggctgcgtattcagaaatctggttcaccgatacgtac
tggccagctttccgacgcgttgactttttgcgagcattgcgagaatactcaaagcgaagc
cgacgcttcggtaaataa

DBGET integrated database retrieval system