KEGG   Corynebacterium diphtheriae 241: CD241_1837Help
Entry
CD241_1837        CDS       T01687                                 

Gene name
gpx
Definition
(GenBank) Glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
cdp  Corynebacterium diphtheriae 241
Pathway
cdp00480  Glutathione metabolism
cdp00590  Arachidonic acid metabolism
cdp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    CD241_1837 (gpx)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CD241_1837 (gpx)
Enzymes [BR:cdp01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CD241_1837 (gpx)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: AEX44894
Position
complement(1946104..1946574)
Genome map
AA seq 156 aa AA seqDB search
MSIFDTEVTLINGEKASMDQWAGHCLLIVNTASECGYTPQLETLEELYEDYAMRGFFVIG
VPCNQFGEEEPGKDAQVARRYEEKFGVRFPLLAKSDVNGPNTIELYKKLKGDGPDIEWNF
EKFIVAPSGEVVGRFAPSLNPDDMKIINVLEEYLPI
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgagtatttttgataccgaggtcacgctgatcaacggcgagaaagcctcaatggatcag
tgggctggtcattgcctgttgattgtgaatacggcatcagagtgcggctataccccgcag
ctggagacgctggaagagctttatgaggattatgcgatgcgtggtttcttcgtaatcggt
gttccgtgtaaccagttcggggaggaagaacctggcaaggatgctcaggtggcgcgtcga
tacgaagaaaagtttggggtgcgcttcccgctgttggctaagtcggacgtcaatggcccc
aacactattgagctgtataagaagctcaagggtgatggtccagatattgagtggaacttt
gaaaagtttatcgtagcgcccagcggtgaggtggtaggccgctttgcgccctcgcttaat
cctgacgatatgaagatcattaacgtcttagaagagtatcttcctatctaa

DBGET integrated database retrieval system