KEGG   Chelatococcus daeguensis: BOQ54_01940Help
Entry
BOQ54_01940       CDS       T04583                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cdq  Chelatococcus daeguensis
Pathway
cdq00020  Citrate cycle (TCA cycle)
cdq00310  Lysine degradation
cdq00380  Tryptophan metabolism
cdq01100  Metabolic pathways
cdq01110  Biosynthesis of secondary metabolites
cdq01120  Microbial metabolism in diverse environments
cdq01130  Biosynthesis of antibiotics
cdq01200  Carbon metabolism
Module
cdq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cdq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cdq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BOQ54_01940
  09105 Amino acid metabolism
   00310 Lysine degradation
    BOQ54_01940
   00380 Tryptophan metabolism
    BOQ54_01940
Enzymes [BR:cdq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BOQ54_01940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 HlyD_D23 DUF2939
Motif
Other DBs
NCBI-ProteinID: APF36241
Position
complement(425062..426288)
Genome map
AA seq 408 aa AA seqDB search
MATEIRVPTLGESVTEATIGRWFKKPGEAVKADEPLVELETDKVTLEVNAPSAGVLAEVT
VNEGDTVEVGALLGSITEGAGGAVAKTAEKPAEKKEEAPKAEASKAAAPGAADDHGPAVR
RIAEETGVSPATVGGTGKDGRVTKGDMLAAVASGVSASPAPSAPVQVRAPSAPDDASREE
RVRMTKLRQTIARRLKDAQQTAAMLTTFNDVDMSGVMALRSQYKDAFEKKHGVKLGFMGF
FVKACVQALKELPAVNAEIDGSDIIYKNYYHVGVAVGTDKGLVVPVVRDADQLSVAGIEK
TIGDFGKRARDGQLKIEEMQGGTFTISNGGVYGSLLSTPILNAPQSAILGMHRIEERPVA
RNGQVVIRPMMYLALSYDHRIIDGKEAVTFLVRVKENLEDPARLVLDL
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccgaaatccgcgtgcccaccctgggcgaatccgtcaccgaggccaccatcggc
cgctggttcaagaagcccggcgaggccgtgaaggccgacgagccgctcgtcgagctcgag
accgacaaggtcacgctcgaggtcaatgcaccctccgccggcgtcctcgccgaagtgacg
gtgaacgagggcgacacggtggaggtcggcgctctcctcggctccatcaccgagggtgcg
ggcggcgcggtcgccaagacggccgagaagcctgcggagaagaaggaagaggcgcccaag
gcggaagcctcaaaggccgcggcgcccggcgccgccgacgaccatggtccggcggtgcgc
cgcatcgccgaggagacgggcgtctccccggccaccgtcggcggtaccggcaaggacggg
cgcgtgaccaagggtgacatgctggccgccgtcgcctcgggcgtctccgcctcgccggcg
ccgtccgccccggtgcaggtccgcgccccctcggcgccggacgatgcctcgcgcgaggag
cgcgtgcgcatgaccaagctgcgccagaccatcgcccgccgcctcaaggacgctcagcag
accgccgccatgctgacgacgttcaacgacgtcgacatgtcgggcgtgatggcactgcgc
agccagtacaaggatgccttcgagaagaagcatggggtcaagctcggcttcatgggcttc
ttcgtgaaggcctgcgtgcaggcgctgaaggagctgccggccgtcaacgccgagatcgac
ggcagcgacatcatctacaagaactactatcacgtcggcgtcgccgtcggcaccgacaag
ggcctcgtcgtgccggtggtgcgcgatgccgaccagctctcggtcgccggcatcgagaag
acgatcggtgacttcggcaagcgcgcccgcgacggccagctgaagatcgaggagatgcag
ggtggcaccttcaccatctccaacggcggcgtctacggctcgctgctctcgacgccgatc
ctcaatgcgccgcagtcggccatcctcggcatgcaccgcatcgaggagcgcccggtcgcc
cgcaacggccaggtcgtcatccgcccgatgatgtatctcgcgctctcctatgaccaccgc
attatcgacggcaaggaagccgtcaccttcctggtgcgcgtgaaggagaacctcgaggac
ccggcgcgcctcgtgctcgacctctga

DBGET integrated database retrieval system