KEGG   Chelatococcus daeguensis: BOQ54_02425Help
Entry
BOQ54_02425       CDS       T04583                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
cdq  Chelatococcus daeguensis
Brite
KEGG Orthology (KO) [BR:cdq00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    BOQ54_02425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 LTD
Motif
Other DBs
NCBI-ProteinID: APF36321
Position
complement(529091..529483)
Genome map
AA seq 130 aa AA seqDB search
MYRAETKGIRVTVEPRFLEDESSPRDGRFFWSYTVEIVNLSAETVQLKTRHWTITDGEGR
SQEVHGPGVIGEEPILEPGESFTYTSGCPLSTAHGTMVGSYDMITQRGERFPVDIPLFPL
DSPYVRRVMH
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtacagggccgaaaccaagggaattcgcgtcactgtcgagccgcgtttcctcgaggat
gaatcttcgccgcgcgacggacgctttttctggtcctacacggtcgagatcgtcaatctc
agcgccgagacggtgcagctcaagacccgccactggacgatcaccgacggcgagggccgc
tcgcaggaggtgcacggccccggcgtcatcggcgaggagcccatccttgagccgggtgag
agcttcacctacaccagcggctgccccctttcaacggcccacggcacgatggtcggctcc
tacgacatgatcacgcagcgcggcgagcgttttcccgtggatatcccgctgttcccgctg
gacagcccctatgtgcggcgggtcatgcattga

DBGET integrated database retrieval system