KEGG   Chelatococcus daeguensis: BOQ54_02480Help
Entry
BOQ54_02480       CDS       T04583                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cdq  Chelatococcus daeguensis
Pathway
cdq00071  Fatty acid degradation
cdq00072  Synthesis and degradation of ketone bodies
cdq00280  Valine, leucine and isoleucine degradation
cdq00310  Lysine degradation
cdq00362  Benzoate degradation
cdq00380  Tryptophan metabolism
cdq00620  Pyruvate metabolism
cdq00630  Glyoxylate and dicarboxylate metabolism
cdq00640  Propanoate metabolism
cdq00650  Butanoate metabolism
cdq00900  Terpenoid backbone biosynthesis
cdq01100  Metabolic pathways
cdq01110  Biosynthesis of secondary metabolites
cdq01120  Microbial metabolism in diverse environments
cdq01130  Biosynthesis of antibiotics
cdq01200  Carbon metabolism
cdq01212  Fatty acid metabolism
cdq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cdq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BOQ54_02480
   00630 Glyoxylate and dicarboxylate metabolism
    BOQ54_02480
   00640 Propanoate metabolism
    BOQ54_02480
   00650 Butanoate metabolism
    BOQ54_02480
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BOQ54_02480
   00072 Synthesis and degradation of ketone bodies
    BOQ54_02480
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BOQ54_02480
   00310 Lysine degradation
    BOQ54_02480
   00380 Tryptophan metabolism
    BOQ54_02480
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BOQ54_02480
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BOQ54_02480
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BOQ54_02480
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cdq04147]
    BOQ54_02480
Enzymes [BR:cdq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BOQ54_02480
Exosome [BR:cdq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BOQ54_02480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III BcrAD_BadFG Porin_3
Motif
Other DBs
NCBI-ProteinID: APF36328
Position
540889..542055
Genome map
AA seq 388 aa AA seqDB search
MTAAIVGWAHTPFGKLDSESVESLIVRVANEALAHAGIGADDVDEIVLGHFNGGFSQQDF
TASLVLQADPAFRFKPATRVENACATGSAAVQQGLKTIAARDARVVLVVGVEQMTTTPGP
EIGKNLLKASYLKEEGDITGGFAGVFGKIAAAYFQRHGDQSDALAMIAAKNHRNGVDNPY
AQMRKDLGFDFCRAESEKNPIVAGPLKRTDCSLVSDGAAAIVLADIETALKMRRAVAFRS
TAHAQDFLPLSRRDILKFEGCAKAWADALDRAGLTLDDLSFVETHDCFTIAELIEYEAMG
LVPEGEGARAIKEGWTEKGGRLPVNPSGGLKAKGHPIGATGVSMHALSAMQLCGEAGGIQ
VPGATLAGIFNMGGAAVANYVSVLERIK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcggcaatcgtcggctgggcccatacgccgttcggcaagctcgacagcgagagc
gtcgaaagcctcatcgtccgcgtcgccaacgaggcgctcgcccatgccggcatcggcgcc
gacgatgtcgacgagatcgtgctcggccatttcaacggcggcttctcgcagcaggacttc
acggcctcgctcgtgctgcaggccgatcccgcgttccgcttcaagccggccacgcgcgtc
gagaacgcctgcgccaccggctcggccgccgtccagcagggcctcaagaccatcgccgcc
cgtgatgcgcgcgtcgtgcttgtcgtcggcgtcgagcagatgacgacgacgcccggtccc
gagatcggcaagaacctgctcaaggcctcctatctcaaagaggaaggcgacatcaccggc
ggcttcgccggcgtcttcggcaagatcgccgctgcctatttccagcgccacggcgaccag
tccgacgcgctcgccatgatcgcggccaagaaccacaggaacggcgtcgacaacccctac
gcccagatgcgcaaggatctcggcttcgacttctgccgcgccgagagcgagaagaacccc
atcgtcgcagggccgctgaagcgcacggactgctccctcgtctccgatggcgcggccgcc
atcgtcctcgccgacattgagacggccttgaagatgcgccgggccgtcgctttccgcagc
acggcccatgcccaggacttcctgcccctgtcgcgccgcgatatcctcaagttcgagggc
tgcgccaaggcctgggccgatgcgctcgaccgcgccggcctgacgctcgacgacctgtcc
ttcgtcgagacgcacgattgcttcaccatcgccgagctcatcgaatacgaggccatgggc
ctcgtgcccgagggcgagggcgcgcgcgccatcaaggagggctggacggagaagggcggg
cgcctgccggtcaatccctccggcggcctcaaggccaagggccatcccatcggcgcgacg
ggcgtctccatgcacgcgctctccgccatgcagctgtgcggcgaggccgggggcatccag
gtgccaggcgcgacccttgccggcatcttcaacatgggcggggcggcagtcgccaactac
gtgtcggtgctcgagcgcatcaagtaa

DBGET integrated database retrieval system