KEGG   Corynebacterium diphtheriae HC03: CDHC03_1156Help
Entry
CDHC03_1156       CDS       T01695                                 

Gene name
fhs
Definition
(GenBank) formate-tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
cdr  Corynebacterium diphtheriae HC03
Pathway
cdr00670  One carbon pool by folate
cdr01100  Metabolic pathways
cdr01120  Microbial metabolism in diverse environments
cdr01200  Carbon metabolism
Module
cdr_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:cdr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    CDHC03_1156 (fhs)
Enzymes [BR:cdr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     CDHC03_1156 (fhs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS NVEALA
Motif
Other DBs
NCBI-ProteinID: AEX78887
Position
complement(1219420..1221072)
Genome map
AA seq 550 aa AA seqDB search
MPTDVEIAQAHTLEHITDIANRAGVPSDALIPYGFTKAKIDINRIASENTGKLVLVTGIS
PTPAGEGKSTVLIGLSDAMRLRGHNSIVAIREPSLGPVMGIKGGAAGGGYSQIVPMEDIN
LHFTGDFHAITAANNTLAAMIDNHIHQGNTLGIDVRRITWQRCLDVNDRSLRKVVTGLGG
KAHGVPTETGFTITAASEIMAILCLALDLTDLEARLARIVVGQTFSSEPVTVGQLNAQGA
LAALLRDAVNPNLVQTLGGTPALCHGGPFANIAHGCNSLIATKTALSLGDVVLTEAGFGS
DLGAEKFFDIKSRVGDLNVAATVVVATVRSLKYNAGVPKDELTTENLEALASGVVNLERH
VENIRAFGIEPIVALNKFASDTDAEINQLKAWAETMSVQLIPVEVWAHGGQGALELADAV
AVSMQKQTSHQLYDPELGIEASLLTIAQKIYGAADVELSKQARQDLAYLQENGWDRLPVC
ISKTQYSFSDDPSQLGRPEGHTLHVRNLLPRIGAGFIVALTGDVMTMPGLPKKPAAENIG
VENGEIKGLF
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgccgacggacgttgaaattgcccaagctcataccctcgagcacatcactgacattgcc
aatcgagctggagtaccttccgatgctctgatcccttatggctttacaaaagcgaaaata
gatattaatcggattgcgagcgaaaacactggaaaactcgtgctcgtgacagggatttca
ccaacgcctgccggcgaaggtaaatcgactgtcctcattggtctttcggacgcaatgaga
ctacgcggccataattccattgttgctattcgtgaaccttctctaggccccgtaatggga
attaaaggtggagccgcaggtggtggatattcacagatcgttcctatggaagacatcaat
ctgcatttcactggagactttcatgcaatcacggcagctaacaacacgctggcagcaatg
attgacaatcatattcatcaaggcaatactctaggaattgatgtccgtcggattacttgg
caacgttgcctggatgtaaacgaccgctctttgcgcaaagttgtgactggcctaggtggt
aaagcacatggggtgccaactgaaacaggattcacgattacagccgcgagtgaaatcatg
gcgattctatgtctggcattagatctaacagatttggaagcacgcttggcacggattgtt
gtaggccagacatttagcagtgaaccagttaccgttggtcaacttaatgcgcaaggagca
cttgcagcgttgcttcgtgatgcagttaatccaaatttagttcaaacattgggtggaaca
cctgcgttgtgccatggtgggccattcgcgaatattgcccatgggtgtaactctcttatc
gctacaaaaacggcgctgtcactcggagatgtcgtactgacggaagcaggatttgggtcc
gacctcggtgccgaaaaattcttcgatattaagtcgcgcgtaggcgacctcaatgttgct
gcaaccgtcgttgtcgcaactgtaaggtctcttaaatacaacgccggcgttcctaaagat
gagctcacaaccgaaaacctggaagctcttgcatctggagtcgtcaatctcgaacggcac
gttgaaaatattcgtgcgtttggtatcgaaccaattgttgcactgaataaatttgcctcg
gacactgatgcagaaatcaatcagctcaaagcttgggctgaaaccatgtcggtccaattg
atcccggtcgaagtttgggctcatggtgggcaaggcgcgctagaacttgccgacgcagtt
gcagtctcgatgcaaaaacaaacttcgcatcaactttatgaccccgaactgggaattgaa
gcatcactgctcacaattgcgcaaaaaatctacggcgcggcagatgttgagttgtcgaag
caagcgcgtcaagatctggcatatttgcaagaaaatggatgggatcgcttgccagtatgt
atttccaagacacaatattcattcagtgatgatccatctcagctagggcgtccagaagga
catactcttcacgttcgcaatttattgccacgaatcggtgcaggatttatcgttgctctt
accggtgatgtcatgaccatgcctggccttccgaaaaaaccagccgctgaaaacatcgga
gttgaaaatggagagattaaaggccttttctaa

DBGET integrated database retrieval system